Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4311387..4312005 | Replicon | chromosome |
| Accession | NZ_CP117575 | ||
| Organism | Escherichia albertii strain BIA_5 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS037_RS20750 | Protein ID | WP_001280991.1 |
| Coordinates | 4311387..4311605 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | PS037_RS20755 | Protein ID | WP_273821340.1 |
| Coordinates | 4311631..4312005 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS037_RS20715 (4306677) | 4306677..4307249 | + | 573 | WP_059256696.1 | YbaY family lipoprotein | - |
| PS037_RS20720 (4307279) | 4307279..4307590 | - | 312 | WP_000409915.1 | MGMT family protein | - |
| PS037_RS20730 (4307971) | 4307971..4308324 | + | 354 | WP_000878150.1 | DUF1428 family protein | - |
| PS037_RS20735 (4308362) | 4308362..4309912 | - | 1551 | WP_273821339.1 | EAL domain-containing protein | - |
| PS037_RS20740 (4310076) | 4310076..4310546 | - | 471 | WP_059224581.1 | YlaC family protein | - |
| PS037_RS20745 (4310653) | 4310653..4311210 | - | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| PS037_RS20750 (4311387) | 4311387..4311605 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS037_RS20755 (4311631) | 4311631..4312005 | - | 375 | WP_273821340.1 | Hha toxicity modulator TomB | Antitoxin |
| PS037_RS20760 (4312560) | 4312560..4315709 | - | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS037_RS20765 (4315732) | 4315732..4316925 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271490 WP_001280991.1 NZ_CP117575:c4311605-4311387 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14527.41 Da Isoelectric Point: 4.8989
>AT271490 WP_273821340.1 NZ_CP117575:c4312005-4311631 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNVTKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNVTKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|