Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3714898..3715730 Replicon chromosome
Accession NZ_CP117575
Organism Escherichia albertii strain BIA_5

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag PS037_RS17995 Protein ID WP_098402592.1
Coordinates 3715353..3715730 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag PS037_RS17990 Protein ID WP_098402589.1
Coordinates 3714898..3715263 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS037_RS17955 (3710347) 3710347..3711648 + 1302 WP_170957137.1 hypothetical protein -
PS037_RS17960 (3711711) 3711711..3712250 + 540 WP_098402573.1 DUF4234 domain-containing protein -
PS037_RS17965 (3712326) 3712326..3712547 + 222 Protein_3507 DUF905 family protein -
PS037_RS17970 (3712647) 3712647..3713465 + 819 WP_098402578.1 DUF932 domain-containing protein -
PS037_RS17975 (3713557) 3713557..3714042 + 486 WP_273821263.1 antirestriction protein -
PS037_RS17980 (3714058) 3714058..3714534 + 477 WP_123058036.1 RadC family protein -
PS037_RS17985 (3714597) 3714597..3714818 + 222 WP_098402587.1 DUF987 domain-containing protein -
PS037_RS17990 (3714898) 3714898..3715263 + 366 WP_098402589.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PS037_RS17995 (3715353) 3715353..3715730 + 378 WP_098402592.1 TA system toxin CbtA family protein Toxin
PS037_RS18000 (3715727) 3715727..3716215 + 489 WP_098402594.1 DUF5983 family protein -
PS037_RS18005 (3716233) 3716233..3716430 + 198 WP_098402597.1 DUF957 domain-containing protein -
PS037_RS18010 (3716633) 3716633..3717091 + 459 WP_273821264.1 IS200/IS605 family transposase -
PS037_RS18015 (3717228) 3717228..3717377 + 150 Protein_3517 restriction endonuclease subunit M -
PS037_RS18020 (3717757) 3717757..3718251 + 495 WP_059270779.1 hypothetical protein -
PS037_RS18025 (3718428) 3718428..3718985 + 558 WP_000955766.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - nleB1 / nleE / vat / vat 3693286..3728768 35482
- flank IS/Tn - - 3716633..3717091 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(17-116)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14262.29 Da        Isoelectric Point: 7.7761

>T271488 WP_098402592.1 NZ_CP117575:3715353-3715730 [Escherichia albertii]
MKTLPDTHVREASLCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCNAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEEKR

Download         Length: 378 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13476.24 Da        Isoelectric Point: 6.6247

>AT271488 WP_098402589.1 NZ_CP117575:3714898-3715263 [Escherichia albertii]
VSDTLPGTTHPNDNNRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSGE
LNPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References