Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3714898..3715730 | Replicon | chromosome |
| Accession | NZ_CP117575 | ||
| Organism | Escherichia albertii strain BIA_5 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | PS037_RS17995 | Protein ID | WP_098402592.1 |
| Coordinates | 3715353..3715730 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PS037_RS17990 | Protein ID | WP_098402589.1 |
| Coordinates | 3714898..3715263 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS037_RS17955 (3710347) | 3710347..3711648 | + | 1302 | WP_170957137.1 | hypothetical protein | - |
| PS037_RS17960 (3711711) | 3711711..3712250 | + | 540 | WP_098402573.1 | DUF4234 domain-containing protein | - |
| PS037_RS17965 (3712326) | 3712326..3712547 | + | 222 | Protein_3507 | DUF905 family protein | - |
| PS037_RS17970 (3712647) | 3712647..3713465 | + | 819 | WP_098402578.1 | DUF932 domain-containing protein | - |
| PS037_RS17975 (3713557) | 3713557..3714042 | + | 486 | WP_273821263.1 | antirestriction protein | - |
| PS037_RS17980 (3714058) | 3714058..3714534 | + | 477 | WP_123058036.1 | RadC family protein | - |
| PS037_RS17985 (3714597) | 3714597..3714818 | + | 222 | WP_098402587.1 | DUF987 domain-containing protein | - |
| PS037_RS17990 (3714898) | 3714898..3715263 | + | 366 | WP_098402589.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PS037_RS17995 (3715353) | 3715353..3715730 | + | 378 | WP_098402592.1 | TA system toxin CbtA family protein | Toxin |
| PS037_RS18000 (3715727) | 3715727..3716215 | + | 489 | WP_098402594.1 | DUF5983 family protein | - |
| PS037_RS18005 (3716233) | 3716233..3716430 | + | 198 | WP_098402597.1 | DUF957 domain-containing protein | - |
| PS037_RS18010 (3716633) | 3716633..3717091 | + | 459 | WP_273821264.1 | IS200/IS605 family transposase | - |
| PS037_RS18015 (3717228) | 3717228..3717377 | + | 150 | Protein_3517 | restriction endonuclease subunit M | - |
| PS037_RS18020 (3717757) | 3717757..3718251 | + | 495 | WP_059270779.1 | hypothetical protein | - |
| PS037_RS18025 (3718428) | 3718428..3718985 | + | 558 | WP_000955766.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | nleB1 / nleE / vat / vat | 3693286..3728768 | 35482 | |
| - | flank | IS/Tn | - | - | 3716633..3717091 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14262.29 Da Isoelectric Point: 7.7761
>T271488 WP_098402592.1 NZ_CP117575:3715353-3715730 [Escherichia albertii]
MKTLPDTHVREASLCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCNAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEEKR
MKTLPDTHVREASLCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCNAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEEKR
Download Length: 378 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13476.24 Da Isoelectric Point: 6.6247
>AT271488 WP_098402589.1 NZ_CP117575:3714898-3715263 [Escherichia albertii]
VSDTLPGTTHPNDNNRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSGE
LNPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTHPNDNNRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSGE
LNPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|