Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3182595..3183211 | Replicon | chromosome |
Accession | NZ_CP117575 | ||
Organism | Escherichia albertii strain BIA_5 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PS037_RS15420 | Protein ID | WP_107192776.1 |
Coordinates | 3182837..3183211 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PS037_RS15415 | Protein ID | WP_103054107.1 |
Coordinates | 3182595..3182837 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS037_RS15375 (3177887) | 3177887..3178324 | + | 438 | WP_000560979.1 | D-aminoacyl-tRNA deacylase | - |
PS037_RS15380 (3178369) | 3178369..3179310 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PS037_RS15385 (3179374) | 3179374..3180282 | - | 909 | WP_059239594.1 | alpha/beta hydrolase | - |
PS037_RS15390 (3180511) | 3180511..3180822 | + | 312 | WP_000897302.1 | hypothetical protein | - |
PS037_RS15395 (3180823) | 3180823..3181113 | + | 291 | WP_000356397.1 | NadS family protein | - |
PS037_RS15400 (3181198) | 3181198..3181410 | + | 213 | WP_000197774.1 | hypothetical protein | - |
PS037_RS15405 (3181472) | 3181472..3181750 | + | 279 | WP_032278934.1 | hypothetical protein | - |
PS037_RS15410 (3182149) | 3182149..3182367 | + | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
PS037_RS15415 (3182595) | 3182595..3182837 | + | 243 | WP_103054107.1 | CopG family transcriptional regulator | Antitoxin |
PS037_RS15420 (3182837) | 3182837..3183211 | + | 375 | WP_107192776.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PS037_RS15425 (3183248) | 3183248..3184177 | - | 930 | WP_000027704.1 | formate dehydrogenase accessory protein FdhE | - |
PS037_RS15430 (3184174) | 3184174..3184809 | - | 636 | WP_000829019.1 | formate dehydrogenase cytochrome b556 subunit | - |
PS037_RS15435 (3184806) | 3184806..3185708 | - | 903 | WP_000331386.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13944.15 Da Isoelectric Point: 8.4539
>T271486 WP_107192776.1 NZ_CP117575:3182837-3183211 [Escherichia albertii]
MAKRTALFDTNILIDLFSGRIESKQALEAWPLQNAISLVTWMEVLVGAKKYNQEHRTQIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVITPYQP
MAKRTALFDTNILIDLFSGRIESKQALEAWPLQNAISLVTWMEVLVGAKKYNQEHRTQIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVITPYQP
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|