Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2920430..2921261 | Replicon | chromosome |
| Accession | NZ_CP117575 | ||
| Organism | Escherichia albertii strain BIA_5 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | PS037_RS14160 | Protein ID | WP_001560291.1 |
| Coordinates | 2920887..2921261 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PS037_RS14155 | Protein ID | WP_247164446.1 |
| Coordinates | 2920430..2920798 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS037_RS14120 (2915659) | 2915659..2916729 | + | 1071 | WP_273821149.1 | patatin-like phospholipase family protein | - |
| PS037_RS14125 (2916865) | 2916865..2917536 | + | 672 | WP_273821885.1 | hypothetical protein | - |
| PS037_RS14130 (2917549) | 2917549..2917959 | + | 411 | WP_273821150.1 | hypothetical protein | - |
| PS037_RS14135 (2918180) | 2918180..2918998 | + | 819 | WP_273821151.1 | DUF932 domain-containing protein | - |
| PS037_RS14140 (2919090) | 2919090..2919575 | + | 486 | WP_100089151.1 | antirestriction protein | - |
| PS037_RS14145 (2919590) | 2919590..2920066 | + | 477 | WP_273821152.1 | RadC family protein | - |
| PS037_RS14150 (2920129) | 2920129..2920350 | + | 222 | WP_098402587.1 | DUF987 domain-containing protein | - |
| PS037_RS14155 (2920430) | 2920430..2920798 | + | 369 | WP_247164446.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PS037_RS14160 (2920887) | 2920887..2921261 | + | 375 | WP_001560291.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| PS037_RS14165 (2921258) | 2921258..2921411 | + | 154 | Protein_2779 | DUF5983 family protein | - |
| PS037_RS14170 (2922384) | 2922384..2922572 | + | 189 | WP_042017791.1 | DUF957 domain-containing protein | - |
| PS037_RS14175 (2922650) | 2922650..2923491 | + | 842 | Protein_2781 | DUF4942 domain-containing protein | - |
| PS037_RS14180 (2923908) | 2923908..2924678 | + | 771 | Protein_2782 | site-specific integrase | - |
| PS037_RS14185 (2924678) | 2924678..2925319 | + | 642 | Protein_2783 | DUF4942 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2919590..2937449 | 17859 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.00 Da Isoelectric Point: 7.8522
>T271484 WP_001560291.1 NZ_CP117575:2920887-2921261 [Escherichia albertii]
MKTLPVLPGQAASSRPSPVEIWQILLTRLLDQHYGLTLNDTPFADERVIELHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLTRLLDQHYGLTLNDTPFADERVIELHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13602.34 Da Isoelectric Point: 5.9546
>AT271484 WP_247164446.1 NZ_CP117575:2920430-2920798 [Escherichia albertii]
VSDTLHEANHPDNNNNSPWWGLPCTVTPCFGARLVQESNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLHEANHPDNNNNSPWWGLPCTVTPCFGARLVQESNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|