Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2049871..2050522 | Replicon | chromosome |
| Accession | NZ_CP117575 | ||
| Organism | Escherichia albertii strain BIA_5 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B1EG01 |
| Locus tag | PS037_RS09915 | Protein ID | WP_000244763.1 |
| Coordinates | 2049871..2050275 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PS037_RS09920 | Protein ID | WP_000354046.1 |
| Coordinates | 2050256..2050522 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS037_RS09895 (2045834) | 2045834..2047567 | - | 1734 | WP_273821829.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PS037_RS09900 (2047573) | 2047573..2048283 | - | 711 | WP_273821830.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PS037_RS09905 (2048308) | 2048308..2049204 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PS037_RS09910 (2049316) | 2049316..2049837 | + | 522 | WP_273821831.1 | flavodoxin FldB | - |
| PS037_RS09915 (2049871) | 2049871..2050275 | - | 405 | WP_000244763.1 | protein YgfX | Toxin |
| PS037_RS09920 (2050256) | 2050256..2050522 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PS037_RS09925 (2050512) | 2050512..2050742 | - | 231 | WP_000181267.1 | hypothetical protein | - |
| PS037_RS09930 (2050774) | 2050774..2051754 | + | 981 | WP_059273222.1 | tRNA-modifying protein YgfZ | - |
| PS037_RS09935 (2051956) | 2051956..2052615 | - | 660 | WP_000250281.1 | hemolysin III family protein | - |
| PS037_RS09940 (2052783) | 2052783..2053094 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| PS037_RS09945 (2053139) | 2053139..2054572 | + | 1434 | WP_024164724.1 | 6-phospho-beta-glucosidase BglA | - |
| PS037_RS09950 (2054620) | 2054620..2055513 | - | 894 | WP_059214571.1 | transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271479 WP_000244763.1 NZ_CP117575:c2050275-2049871 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6P9B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |