Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 22980..23581 Replicon plasmid pEA50_2
Accession NZ_CP117572
Organism Escherichia albertii strain BIA_50

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag PS035_RS23890 Protein ID WP_001216045.1
Coordinates 23201..23581 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PS035_RS23885 Protein ID WP_001190712.1
Coordinates 22980..23201 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS035_RS23845 (PS035_23845) 18375..18668 + 294 WP_000269004.1 hypothetical protein -
PS035_RS23850 (PS035_23850) 18675..19049 + 375 WP_001749397.1 hypothetical protein -
PS035_RS23855 (PS035_23855) 19031..19627 + 597 WP_273818034.1 hypothetical protein -
PS035_RS23860 (PS035_23860) 19632..19967 + 336 WP_243043453.1 hypothetical protein -
PS035_RS23865 (PS035_23865) 19964..20326 + 363 WP_001261543.1 hypothetical protein -
PS035_RS23870 (PS035_23870) 21402..21758 - 357 WP_001062545.1 hypothetical protein -
PS035_RS23875 (PS035_23875) 21759..22343 - 585 WP_001749394.1 hypothetical protein -
PS035_RS23880 (PS035_23880) 22518..22907 + 390 WP_000506730.1 S24 family peptidase -
PS035_RS23885 (PS035_23885) 22980..23201 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PS035_RS23890 (PS035_23890) 23201..23581 + 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PS035_RS23895 (PS035_23895) 23586..23765 + 180 WP_000113018.1 hypothetical protein -
PS035_RS23900 (PS035_23900) 23793..24836 + 1044 WP_273784097.1 DUF968 domain-containing protein -
PS035_RS23905 (PS035_23905) 24925..25377 + 453 WP_032165150.1 Late promoter-activating protein -
PS035_RS23910 (PS035_23910) 25414..26589 - 1176 WP_000942666.1 RNA-guided endonuclease TnpB family protein -
PS035_RS23915 (PS035_23915) 26797..27990 + 1194 WP_000219618.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..100730 100730
- flank IS/Tn - - 25414..26589 1175


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T271467 WP_001216045.1 NZ_CP117572:23201-23581 [Escherichia albertii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT271467 WP_001190712.1 NZ_CP117572:22980-23201 [Escherichia albertii]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References