Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 22980..23581 | Replicon | plasmid pEA50_2 |
| Accession | NZ_CP117572 | ||
| Organism | Escherichia albertii strain BIA_50 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | PS035_RS23890 | Protein ID | WP_001216045.1 |
| Coordinates | 23201..23581 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | PS035_RS23885 | Protein ID | WP_001190712.1 |
| Coordinates | 22980..23201 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS035_RS23845 (PS035_23845) | 18375..18668 | + | 294 | WP_000269004.1 | hypothetical protein | - |
| PS035_RS23850 (PS035_23850) | 18675..19049 | + | 375 | WP_001749397.1 | hypothetical protein | - |
| PS035_RS23855 (PS035_23855) | 19031..19627 | + | 597 | WP_273818034.1 | hypothetical protein | - |
| PS035_RS23860 (PS035_23860) | 19632..19967 | + | 336 | WP_243043453.1 | hypothetical protein | - |
| PS035_RS23865 (PS035_23865) | 19964..20326 | + | 363 | WP_001261543.1 | hypothetical protein | - |
| PS035_RS23870 (PS035_23870) | 21402..21758 | - | 357 | WP_001062545.1 | hypothetical protein | - |
| PS035_RS23875 (PS035_23875) | 21759..22343 | - | 585 | WP_001749394.1 | hypothetical protein | - |
| PS035_RS23880 (PS035_23880) | 22518..22907 | + | 390 | WP_000506730.1 | S24 family peptidase | - |
| PS035_RS23885 (PS035_23885) | 22980..23201 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS035_RS23890 (PS035_23890) | 23201..23581 | + | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PS035_RS23895 (PS035_23895) | 23586..23765 | + | 180 | WP_000113018.1 | hypothetical protein | - |
| PS035_RS23900 (PS035_23900) | 23793..24836 | + | 1044 | WP_273784097.1 | DUF968 domain-containing protein | - |
| PS035_RS23905 (PS035_23905) | 24925..25377 | + | 453 | WP_032165150.1 | Late promoter-activating protein | - |
| PS035_RS23910 (PS035_23910) | 25414..26589 | - | 1176 | WP_000942666.1 | RNA-guided endonuclease TnpB family protein | - |
| PS035_RS23915 (PS035_23915) | 26797..27990 | + | 1194 | WP_000219618.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..100730 | 100730 | |
| - | flank | IS/Tn | - | - | 25414..26589 | 1175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T271467 WP_001216045.1 NZ_CP117572:23201-23581 [Escherichia albertii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |