Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 63191..63816 | Replicon | plasmid pEA50_1 |
Accession | NZ_CP117571 | ||
Organism | Escherichia albertii strain BIA_50 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PS035_RS23120 | Protein ID | WP_000911313.1 |
Coordinates | 63418..63816 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | PS035_RS23115 | Protein ID | WP_000450520.1 |
Coordinates | 63191..63418 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS035_RS23115 (63191) | 63191..63418 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PS035_RS23120 (63418) | 63418..63816 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PS035_RS23125 (63825) | 63825..66023 | - | 2199 | WP_273818024.1 | type IV conjugative transfer system coupling protein TraD | - |
PS035_RS23130 (66276) | 66276..67007 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
PS035_RS23135 (67039) | 67039..67536 | - | 498 | WP_000605857.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | vat / iutA / iucD / iucC / iucB / iucA / espK / paa / vat | 1..165614 | 165614 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T271465 WP_000911313.1 NZ_CP117571:63418-63816 [Escherichia albertii]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|