Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3412633..3413251 | Replicon | chromosome |
Accession | NZ_CP117570 | ||
Organism | Escherichia albertii strain BIA_50 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PS035_RS16535 | Protein ID | WP_001280991.1 |
Coordinates | 3413033..3413251 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B1EKM5 |
Locus tag | PS035_RS16530 | Protein ID | WP_000344798.1 |
Coordinates | 3412633..3413007 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS035_RS16520 (3407713) | 3407713..3408906 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PS035_RS16525 (3408929) | 3408929..3412078 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
PS035_RS16530 (3412633) | 3412633..3413007 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
PS035_RS16535 (3413033) | 3413033..3413251 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PS035_RS16540 (3413428) | 3413428..3413985 | + | 558 | WP_273817357.1 | maltose O-acetyltransferase | - |
PS035_RS16545 (3414093) | 3414093..3414563 | + | 471 | WP_000136187.1 | YlaC family protein | - |
PS035_RS16550 (3414727) | 3414727..3416277 | + | 1551 | WP_273817358.1 | EAL domain-containing protein | - |
PS035_RS16555 (3416315) | 3416315..3416668 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
PS035_RS16565 (3417049) | 3417049..3417360 | + | 312 | WP_000409915.1 | MGMT family protein | - |
PS035_RS16570 (3417390) | 3417390..3417962 | - | 573 | WP_273817359.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271457 WP_001280991.1 NZ_CP117570:3413033-3413251 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271457 WP_000344798.1 NZ_CP117570:3412633-3413007 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|