Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1877402..1877992 | Replicon | chromosome |
| Accession | NZ_CP117570 | ||
| Organism | Escherichia albertii strain BIA_50 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | PS035_RS08890 | Protein ID | WP_059225520.1 |
| Coordinates | 1877660..1877992 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PS035_RS08885 | Protein ID | WP_059225519.1 |
| Coordinates | 1877402..1877659 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS035_RS08875 (1876382) | 1876382..1876852 | + | 471 | WP_059225518.1 | hypothetical protein | - |
| PS035_RS08880 (1876849) | 1876849..1877054 | + | 206 | Protein_1734 | helix-turn-helix transcriptional regulator | - |
| PS035_RS08885 (1877402) | 1877402..1877659 | + | 258 | WP_059225519.1 | hypothetical protein | Antitoxin |
| PS035_RS08890 (1877660) | 1877660..1877992 | + | 333 | WP_059225520.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PS035_RS08895 (1878105) | 1878105..1878482 | + | 378 | WP_161537949.1 | hypothetical protein | - |
| PS035_RS08900 (1878800) | 1878800..1879684 | + | 885 | WP_059225521.1 | integrase domain-containing protein | - |
| PS035_RS08905 (1879780) | 1879780..1880067 | - | 288 | WP_059225522.1 | hypothetical protein | - |
| PS035_RS08910 (1881026) | 1881026..1882288 | - | 1263 | WP_059225524.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11777.59 Da Isoelectric Point: 8.0291
>T271450 WP_059225520.1 NZ_CP117570:1877660-1877992 [Escherichia albertii]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|