Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4193761..4194379 | Replicon | chromosome |
| Accession | NZ_CP117568 | ||
| Organism | Escherichia albertii strain BIA_5-2 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS053_RS20225 | Protein ID | WP_001280991.1 |
| Coordinates | 4193761..4193979 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS053_RS20230 | Protein ID | WP_000344798.1 |
| Coordinates | 4194005..4194379 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS053_RS20190 (4189051) | 4189051..4189623 | + | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
| PS053_RS20195 (4189653) | 4189653..4189964 | - | 312 | WP_000409915.1 | MGMT family protein | - |
| PS053_RS20205 (4190345) | 4190345..4190698 | + | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS053_RS20210 (4190736) | 4190736..4192286 | - | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| PS053_RS20215 (4192450) | 4192450..4192920 | - | 471 | WP_059224581.1 | YlaC family protein | - |
| PS053_RS20220 (4193027) | 4193027..4193584 | - | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| PS053_RS20225 (4193761) | 4193761..4193979 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS053_RS20230 (4194005) | 4194005..4194379 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS053_RS20235 (4194934) | 4194934..4198083 | - | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS053_RS20240 (4198106) | 4198106..4199299 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271445 WP_001280991.1 NZ_CP117568:c4193979-4193761 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271445 WP_000344798.1 NZ_CP117568:c4194379-4194005 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|