Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 3616484..3617191 | Replicon | chromosome |
| Accession | NZ_CP117568 | ||
| Organism | Escherichia albertii strain BIA_5-2 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | PS053_RS17580 | Protein ID | WP_130222476.1 |
| Coordinates | 3616850..3617191 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PS053_RS17575 | Protein ID | WP_130222474.1 |
| Coordinates | 3616484..3616819 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS053_RS17550 (3612430) | 3612430..3612649 | - | 220 | Protein_3420 | AlpA family phage regulatory protein | - |
| PS053_RS17555 (3612767) | 3612767..3613381 | - | 615 | WP_256878726.1 | inovirus Gp2 family protein | - |
| PS053_RS17560 (3613973) | 3613973..3614926 | + | 954 | WP_256878725.1 | hypothetical protein | - |
| PS053_RS17565 (3615163) | 3615163..3615981 | + | 819 | WP_256878724.1 | DUF932 domain-containing protein | - |
| PS053_RS17570 (3616011) | 3616011..3616484 | + | 474 | WP_256878723.1 | DNA repair protein RadC | - |
| PS053_RS17575 (3616484) | 3616484..3616819 | + | 336 | WP_130222474.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PS053_RS17580 (3616850) | 3616850..3617191 | + | 342 | WP_130222476.1 | TA system toxin CbtA family protein | Toxin |
| PS053_RS17585 (3617306) | 3617306..3618140 | + | 835 | Protein_3427 | DUF4942 domain-containing protein | - |
| PS053_RS17590 (3618216) | 3618216..3618464 | + | 249 | WP_000535212.1 | ribbon-helix-helix domain-containing protein | - |
| PS053_RS17595 (3618468) | 3618468..3618743 | + | 276 | WP_001683517.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PS053_RS17600 (3618858) | 3618858..3619655 | + | 798 | WP_256878721.1 | helix-turn-helix transcriptional regulator | - |
| PS053_RS17605 (3619909) | 3619909..3620445 | + | 537 | WP_059221727.1 | hypothetical protein | - |
| PS053_RS17610 (3620776) | 3620776..3621333 | + | 558 | WP_256878720.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | nleB1 / nleE / vat | 3609281..3631125 | 21844 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13047.09 Da Isoelectric Point: 9.9072
>T271439 WP_130222476.1 NZ_CP117568:3616850-3617191 [Escherichia albertii]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAINFLVEKYQLIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCHNTATR
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAINFLVEKYQLIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCHNTATR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|