Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 2601730..2602530 | Replicon | chromosome |
Accession | NZ_CP117568 | ||
Organism | Escherichia albertii strain BIA_5-2 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | B1EHN9 |
Locus tag | PS053_RS12695 | Protein ID | WP_000342453.1 |
Coordinates | 2601730..2602257 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | B1EHP0 |
Locus tag | PS053_RS12700 | Protein ID | WP_001277106.1 |
Coordinates | 2602264..2602530 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS053_RS12670 (2596805) | 2596805..2597572 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
PS053_RS12675 (2597569) | 2597569..2598846 | - | 1278 | WP_256879194.1 | branched chain amino acid ABC transporter permease LivM | - |
PS053_RS12680 (2598843) | 2598843..2599769 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PS053_RS12685 (2599817) | 2599817..2600926 | - | 1110 | WP_256879195.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PS053_RS12690 (2601350) | 2601350..2601733 | + | 384 | WP_000778774.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
PS053_RS12695 (2601730) | 2601730..2602257 | - | 528 | WP_000342453.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
PS053_RS12700 (2602264) | 2602264..2602530 | - | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
PS053_RS12705 (2602680) | 2602680..2603783 | - | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
PS053_RS12710 (2604306) | 2604306..2604707 | + | 402 | WP_001071334.1 | PTS sugar transporter subunit IIA | - |
PS053_RS12715 (2604714) | 2604714..2605199 | + | 486 | WP_000029259.1 | PTS sugar transporter subunit IIB | - |
PS053_RS12720 (2605216) | 2605216..2605962 | + | 747 | WP_000151888.1 | PTS sugar transporter subunit IIC | - |
PS053_RS12725 (2605955) | 2605955..2606809 | + | 855 | WP_000370584.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19676.58 Da Isoelectric Point: 6.9585
>T271436 WP_000342453.1 NZ_CP117568:c2602257-2601730 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|