Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2010326..2010977 | Replicon | chromosome |
Accession | NZ_CP117568 | ||
Organism | Escherichia albertii strain BIA_5-2 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | B1EG01 |
Locus tag | PS053_RS09770 | Protein ID | WP_000244763.1 |
Coordinates | 2010326..2010730 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PS053_RS09775 | Protein ID | WP_000354046.1 |
Coordinates | 2010711..2010977 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS053_RS09750 (2006284) | 2006284..2008017 | - | 1734 | WP_059258720.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PS053_RS09755 (2008023) | 2008023..2008733 | - | 711 | WP_000748105.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PS053_RS09760 (2008758) | 2008758..2009654 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PS053_RS09765 (2009766) | 2009766..2010287 | + | 522 | WP_125060507.1 | flavodoxin FldB | - |
PS053_RS09770 (2010326) | 2010326..2010730 | - | 405 | WP_000244763.1 | protein YgfX | Toxin |
PS053_RS09775 (2010711) | 2010711..2010977 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PS053_RS09780 (2010967) | 2010967..2011197 | - | 231 | WP_000181267.1 | hypothetical protein | - |
PS053_RS09785 (2011229) | 2011229..2012209 | + | 981 | WP_256878858.1 | tRNA-modifying protein YgfZ | - |
PS053_RS09790 (2012649) | 2012649..2013308 | - | 660 | WP_000250281.1 | hemolysin III family protein | - |
PS053_RS09795 (2013476) | 2013476..2013787 | - | 312 | WP_001182937.1 | N(4)-acetylcytidine aminohydrolase | - |
PS053_RS09800 (2013832) | 2013832..2015265 | + | 1434 | WP_025238420.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271433 WP_000244763.1 NZ_CP117568:c2010730-2010326 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6P9B3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |