Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeV-yfjZ/CbtA-CbeA
Location 1756412..1757093 Replicon chromosome
Accession NZ_CP117568
Organism Escherichia albertii strain BIA_5-2

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag PS053_RS08525 Protein ID WP_256879418.1
Coordinates 1756770..1757093 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag PS053_RS08520 Protein ID WP_256879388.1
Coordinates 1756412..1756732 (+) Length 107 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS053_RS08485 (1751499) 1751499..1751777 - 279 WP_256879393.1 helix-turn-helix transcriptional regulator -
PS053_RS08490 (1752041) 1752041..1752475 - 435 WP_256921800.1 DUF3987 domain-containing protein -
PS053_RS08495 (1752469) 1752469..1753452 - 984 WP_256921792.1 DUF3987 domain-containing protein -
PS053_RS08500 (1753772) 1753772..1754443 - 672 WP_256879392.1 inovirus Gp2 family protein -
PS053_RS08505 (1754841) 1754841..1755659 + 819 WP_256879391.1 DUF932 domain-containing protein -
PS053_RS08510 (1755692) 1755692..1756165 + 474 WP_256879390.1 DNA repair protein RadC -
PS053_RS08515 (1756173) 1756173..1756394 + 222 WP_256879389.1 DUF987 family protein -
PS053_RS08520 (1756412) 1756412..1756732 + 321 WP_256879388.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PS053_RS08525 (1756770) 1756770..1757093 + 324 WP_256879418.1 TA system toxin CbtA family protein Toxin
PS053_RS08530 (1757410) 1757410..1757502 + 93 Protein_1674 integrase -
PS053_RS08535 (1758087) 1758087..1758188 + 102 WP_256879387.1 small membrane protein YkgR -
PS053_RS08540 (1758219) 1758219..1758512 - 294 WP_125282434.1 hypothetical protein -
PS053_RS08545 (1758650) 1758650..1758916 + 267 WP_000812362.1 type B 50S ribosomal protein L31 -
PS053_RS08550 (1758913) 1758913..1759053 + 141 WP_000866440.1 type B 50S ribosomal protein L36 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1726102..1762478 36376


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(10-106)

Antitoxin

Antitoxin CbeA

(4-102)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12200.96 Da        Isoelectric Point: 6.0691

>T271430 WP_256879418.1 NZ_CP117568:1756770-1757093 [Escherichia albertii]
ILSVPTTVPISSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDAAIEEHIEAGITLADAVNFLVEKYELVRIDRKGFSW
QEQTPYISVVDILRARRSTGLLKTNVK

Download         Length: 324 bp

Antitoxin


Download         Length: 107 a.a.        Molecular weight: 12010.67 Da        Isoelectric Point: 6.7439

>AT271430 WP_256879388.1 NZ_CP117568:1756412-1756732 [Escherichia albertii]
MKNSWGLKRDMTPCFGARLVQEGRRLHFLADRADISGAFNEEEALRLDQAFPPVMKQLELMLTTGELNPRHQHCVTLHHN
GLTCEADTLGSHGYVYIVIYPQTSSQ

Download         Length: 321 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References