271423

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 8284..8777 Replicon plasmid pEA7_3
Accession NZ_CP117565
Organism Escherichia albertii strain BIA_7

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag PS049_RS26330 Protein ID WP_001230709.1
Coordinates 8284..8538 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag PS049_RS26335 Protein ID WP_000151456.1
Coordinates 8535..8777 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS049_RS26290 (PS049_26290) 3793..3945 + 153 Protein_4 DUF5431 family protein -
PS049_RS26295 (PS049_26295) 3890..4012 + 123 WP_223202818.1 Hok/Gef family protein -
PS049_RS26300 (PS049_26300) 4162..4758 + 597 WP_172943823.1 ProQ/FINO family protein -
PS049_RS26305 (PS049_26305) 4776..5060 - 285 WP_001162371.1 hypothetical protein -
PS049_RS26310 (PS049_26310) 5139..5804 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
PS049_RS26315 (PS049_26315) 6393..6722 + 330 WP_000855119.1 hypothetical protein -
PS049_RS26320 (PS049_26320) 7126..7641 + 516 WP_273820609.1 J domain-containing protein -
PS049_RS26325 (PS049_26325) 7745..8287 + 543 WP_001083904.1 hypothetical protein -
PS049_RS26330 (PS049_26330) 8284..8538 + 255 WP_001230709.1 hypothetical protein Toxin
PS049_RS26335 (PS049_26335) 8535..8777 + 243 WP_000151456.1 hypothetical protein Antitoxin
PS049_RS26340 (PS049_26340) 9347..9628 + 282 WP_097415049.1 hypothetical protein -
PS049_RS26345 (PS049_26345) 9721..10071 + 351 WP_097415050.1 hypothetical protein -
PS049_RS26350 (PS049_26350) 10514..10780 + 267 WP_000681608.1 type II toxin-antitoxin system HicB family antitoxin -
PS049_RS26355 (PS049_26355) 10887..11330 - 444 WP_000068545.1 hypothetical protein -
PS049_RS26360 (PS049_26360) 11627..11809 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
PS049_RS26365 (PS049_26365) 11834..12271 + 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
PS049_RS26370 (PS049_26370) 12398..12724 - 327 WP_000206697.1 hypothetical protein -
PS049_RS26375 (PS049_26375) 12726..13049 - 324 WP_273820636.1 hypothetical protein -
PS049_RS26380 (PS049_26380) 13026..13166 - 141 Protein_22 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..62457 62457
- flank IS/Tn - - 2183..3331 1148


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T271423 WP_001230709.1 NZ_CP117565:8284-8538 [Escherichia albertii]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT271423 WP_000151456.1 NZ_CP117565:8535-8777 [Escherichia albertii]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References