Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 79993..80618 Replicon plasmid pEA7_2
Accession NZ_CP117564
Organism Escherichia albertii strain BIA_7

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PS049_RS26015 Protein ID WP_000911314.1
Coordinates 79993..80391 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID L4J1D2
Locus tag PS049_RS26020 Protein ID WP_000450532.1
Coordinates 80391..80618 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS049_RS25995 (PS049_25995) 75574..76059 + 486 WP_000605865.1 hypothetical protein -
PS049_RS26000 (PS049_26000) 76108..76839 + 732 WP_000782451.1 conjugal transfer complement resistance protein TraT -
PS049_RS26005 (PS049_26005) 77043..77522 + 480 WP_001382783.1 hypothetical protein -
PS049_RS26010 (PS049_26010) 77804..79984 + 2181 WP_273820530.1 type IV conjugative transfer system coupling protein TraD -
PS049_RS26015 (PS049_26015) 79993..80391 - 399 WP_000911314.1 type II toxin-antitoxin system VapC family toxin Toxin
PS049_RS26020 (PS049_26020) 80391..80618 - 228 WP_000450532.1 toxin-antitoxin system antitoxin VapB Antitoxin
PS049_RS26025 (PS049_26025) 80700..82028 + 1329 Protein_100 MobF family relaxase -
PS049_RS26030 (PS049_26030) 82120..83292 + 1173 WP_053264206.1 IS21-like element IS21 family transposase -
PS049_RS26035 (PS049_26035) 83292..84089 + 798 WP_123012753.1 IS21-like element IS21 family helper ATPase IstB -
PS049_RS26040 (PS049_26040) 84148..84741 - 594 Protein_103 IS66 family transposase zinc-finger binding domain-containing protein -
PS049_RS26045 (PS049_26045) 84772..85122 - 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
PS049_RS26050 (PS049_26050) 85119..85544 - 426 WP_000422741.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 1..129910 129910


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(7-51)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14814.12 Da        Isoelectric Point: 7.8604

>T271422 WP_000911314.1 NZ_CP117564:c80391-79993 [Escherichia albertii]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS

Download         Length: 399 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8512.55 Da        Isoelectric Point: 4.5358

>AT271422 WP_000450532.1 NZ_CP117564:c80618-80391 [Escherichia albertii]
METTVFLSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAGETWDEWFDGNSVSADFMDNREQPGMQERESF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829CHF5

References