Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 48228..48753 Replicon plasmid pEA7_2
Accession NZ_CP117564
Organism Escherichia albertii strain BIA_7

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag PS049_RS25830 Protein ID WP_001159871.1
Coordinates 48228..48533 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag PS049_RS25835 Protein ID WP_000813639.1
Coordinates 48535..48753 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS049_RS25805 (PS049_25805) 43705..45240 + 1536 WP_137650562.1 pore-forming bacteriocin colicin B -
PS049_RS25810 (PS049_25810) 45258..45785 - 528 WP_000203274.1 colicin B immunity protein -
PS049_RS25815 (PS049_25815) 46027..46842 + 816 WP_273820555.1 lipid II-degrading bacteriocin colicin M -
PS049_RS25820 (PS049_25820) 46892..47245 - 354 WP_000864816.1 colicin M immunity protein -
PS049_RS25825 (PS049_25825) 47418..48227 - 810 WP_000016972.1 site-specific integrase -
PS049_RS25830 (PS049_25830) 48228..48533 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
PS049_RS25835 (PS049_25835) 48535..48753 - 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PS049_RS25845 (PS049_25845) 50675..50905 + 231 WP_001261277.1 type II toxin-antitoxin system VapB family antitoxin -
PS049_RS25850 (PS049_25850) 50902..51317 + 416 Protein_65 type II toxin-antitoxin system VapC family toxin -
PS049_RS25855 (PS049_25855) 51376..51816 - 441 Protein_66 transposase family protein -
PS049_RS25860 (PS049_25860) 52175..52750 + 576 WP_000813673.1 tyrosine-type DNA invertase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 1..129910 129910


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T271421 WP_001159871.1 NZ_CP117564:c48533-48228 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT271421 WP_000813639.1 NZ_CP117564:c48753-48535 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References