Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 30559..31322 | Replicon | plasmid pEA7_2 |
| Accession | NZ_CP117564 | ||
| Organism | Escherichia albertii strain BIA_7 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | PS049_RS25730 | Protein ID | WP_000405251.1 |
| Coordinates | 30559..31041 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | PS049_RS25735 | Protein ID | WP_001143303.1 |
| Coordinates | 31032..31322 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS049_RS25695 (PS049_25695) | 26349..26828 | + | 480 | Protein_34 | integrase core domain-containing protein | - |
| PS049_RS25700 (PS049_25700) | 26927..27505 | + | 579 | WP_137653473.1 | hypothetical protein | - |
| PS049_RS25705 (PS049_25705) | 27555..27662 | - | 108 | Protein_36 | type II toxin-antitoxin system toxin YacB | - |
| PS049_RS25710 (PS049_25710) | 27662..27916 | - | 255 | WP_149452403.1 | type II toxin-antitoxin system antitoxin YacA | - |
| PS049_RS25715 (PS049_25715) | 28833..29690 | - | 858 | WP_137653556.1 | incFII family plasmid replication initiator RepA | - |
| PS049_RS25720 (PS049_25720) | 29683..29757 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| PS049_RS25725 (PS049_25725) | 29989..30249 | - | 261 | WP_000078113.1 | replication regulatory protein RepA | - |
| PS049_RS25730 (PS049_25730) | 30559..31041 | - | 483 | WP_000405251.1 | GNAT family N-acetyltransferase | Toxin |
| PS049_RS25735 (PS049_25735) | 31032..31322 | - | 291 | WP_001143303.1 | DUF1778 domain-containing protein | Antitoxin |
| PS049_RS25740 (PS049_25740) | 31622..31834 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PS049_RS25745 (PS049_25745) | 31975..32535 | - | 561 | WP_000139333.1 | fertility inhibition protein FinO | - |
| PS049_RS25750 (PS049_25750) | 32590..33336 | - | 747 | WP_074459549.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | espL2 | 1..129910 | 129910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17672.50 Da Isoelectric Point: 7.8646
>T271420 WP_000405251.1 NZ_CP117564:c31041-30559 [Escherichia albertii]
MEINVTAPALLTDEHILQPFDCGNKVLSNWLHGRAMKNQMLNASRTFVICLEGTLRVVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSIVAPNTLFYKV
MEINVTAPALLTDEHILQPFDCGNKVLSNWLHGRAMKNQMLNASRTFVICLEGTLRVVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSIVAPNTLFYKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|