Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 40550..41085 | Replicon | plasmid pEA7_1 |
Accession | NZ_CP117563 | ||
Organism | Escherichia albertii strain BIA_7 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A8H9KAX0 |
Locus tag | PS049_RS24790 | Protein ID | WP_000222759.1 |
Coordinates | 40550..40837 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A8H9KB11 |
Locus tag | PS049_RS24795 | Protein ID | WP_001132891.1 |
Coordinates | 40834..41085 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS049_RS24765 (36066) | 36066..37658 | - | 1593 | WP_006703274.1 | IS66 family transposase | - |
PS049_RS24770 (37689) | 37689..38039 | - | 351 | WP_000624677.1 | IS66 family insertion sequence element accessory protein TnpB | - |
PS049_RS24775 (38036) | 38036..38455 | - | 420 | WP_000422694.1 | transposase | - |
PS049_RS24780 (38931) | 38931..39110 | + | 180 | Protein_33 | transposase domain-containing protein | - |
PS049_RS24785 (39457) | 39457..40414 | - | 958 | Protein_34 | RNA-guided endonuclease TnpB family protein | - |
PS049_RS24790 (40550) | 40550..40837 | - | 288 | WP_000222759.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS049_RS24795 (40834) | 40834..41085 | - | 252 | WP_001132891.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PS049_RS24800 (41607) | 41607..42578 | - | 972 | WP_062862136.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
PS049_RS24805 (42578) | 42578..43744 | - | 1167 | WP_062860116.1 | plasmid-partitioning protein SopA | - |
PS049_RS24810 (44168) | 44168..44948 | - | 781 | Protein_39 | IS21-like element helper ATPase IstB | - |
PS049_RS24815 (44945) | 44945..45755 | - | 811 | Protein_40 | DDE-type integrase/transposase/recombinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | efa1 | 1..177310 | 177310 | |
- | inside | IScluster/Tn | - | - | 36066..57092 | 21026 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11176.23 Da Isoelectric Point: 10.5832
>T271415 WP_000222759.1 NZ_CP117563:c40837-40550 [Escherichia albertii]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRELKNCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRELKNCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|