Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4882170..4882788 | Replicon | chromosome |
Accession | NZ_CP117562 | ||
Organism | Escherichia albertii strain BIA_7 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PS049_RS24250 | Protein ID | WP_001280991.1 |
Coordinates | 4882570..4882788 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B1EKM5 |
Locus tag | PS049_RS24245 | Protein ID | WP_000344798.1 |
Coordinates | 4882170..4882544 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS049_RS24235 (4877250) | 4877250..4878443 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PS049_RS24240 (4878466) | 4878466..4881615 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
PS049_RS24245 (4882170) | 4882170..4882544 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
PS049_RS24250 (4882570) | 4882570..4882788 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PS049_RS24255 (4882965) | 4882965..4883522 | + | 558 | WP_204628716.1 | maltose O-acetyltransferase | - |
PS049_RS24260 (4883630) | 4883630..4884100 | + | 471 | WP_000136188.1 | YlaC family protein | - |
PS049_RS24265 (4884264) | 4884264..4885814 | + | 1551 | WP_054411428.1 | EAL domain-containing protein | - |
PS049_RS24270 (4885852) | 4885852..4886205 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
PS049_RS24280 (4886586) | 4886586..4886897 | + | 312 | WP_000409915.1 | MGMT family protein | - |
PS049_RS24285 (4886927) | 4886927..4887499 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271413 WP_001280991.1 NZ_CP117562:4882570-4882788 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271413 WP_000344798.1 NZ_CP117562:4882170-4882544 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|