Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 4296854..4297327 Replicon chromosome
Accession NZ_CP117562
Organism Escherichia albertii strain BIA_7

Toxin (Protein)


Gene name parE_1 Uniprot ID -
Locus tag PS049_RS21265 Protein ID WP_087205712.1
Coordinates 4297046..4297327 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID -
Locus tag PS049_RS21260 Protein ID WP_087205714.1
Coordinates 4296854..4297042 (+) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS049_RS21220 (4292077) 4292077..4292367 - 291 WP_069723346.1 DUF4752 family protein -
PS049_RS21225 (4292364) 4292364..4293065 - 702 WP_059239302.1 ead/Ea22-like family protein -
PS049_RS21230 (4293052) 4293052..4293804 - 753 WP_089521819.1 DUF1627 domain-containing protein -
PS049_RS21235 (4293827) 4293827..4294573 - 747 WP_273819928.1 ATP-binding protein -
PS049_RS21240 (4294580) 4294580..4295545 - 966 WP_106121408.1 hypothetical protein -
PS049_RS21245 (4295526) 4295526..4296047 - 522 WP_087205716.1 toxin YdaT family protein -
PS049_RS21250 (4296031) 4296031..4296309 - 279 WP_089569460.1 YdaS family helix-turn-helix protein -
PS049_RS21255 (4296426) 4296426..4296824 + 399 WP_032214971.1 helix-turn-helix domain-containing protein -
PS049_RS21260 (4296854) 4296854..4297042 + 189 WP_087205714.1 stability determinant Antitoxin
PS049_RS21265 (4297046) 4297046..4297327 + 282 WP_087205712.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PS049_RS21270 (4297607) 4297607..4297762 + 156 WP_000379575.1 DUF1391 family protein -
PS049_RS21275 (4297764) 4297764..4297892 + 129 WP_000344964.1 protein YdfB -
PS049_RS21280 (4297922) 4297922..4298140 + 219 WP_001171946.1 protein YdfC -
PS049_RS21285 (4298163) 4298163..4298492 + 330 WP_000394536.1 hypothetical protein -
PS049_RS21290 (4298461) 4298461..4298736 - 276 WP_000505224.1 hypothetical protein -
PS049_RS21295 (4299297) 4299297..4299485 + 189 WP_000449192.1 cell division inhibition protein DicB -
PS049_RS21300 (4299482) 4299482..4299673 + 192 WP_001090200.1 DUF1482 family protein -
PS049_RS21305 (4299766) 4299766..4302225 + 2460 WP_273819934.1 exonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - espFu/tccP 4260381..4303737 43356


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10802.51 Da        Isoelectric Point: 6.7152

>T271412 WP_087205712.1 NZ_CP117562:4297046-4297327 [Escherichia albertii]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWKRLRACVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTASSIE
IVSIVHARRQFPR

Download         Length: 282 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 7262.22 Da        Isoelectric Point: 7.0135

>AT271412 WP_087205714.1 NZ_CP117562:4296854-4297042 [Escherichia albertii]
MNTALSPMVSEFETIEQENSYNEWLRAKVAASLADPRPTIPHDEVERRMAERFAKIRKERSK

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References