Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2121767..2122418 | Replicon | chromosome |
Accession | NZ_CP117562 | ||
Organism | Escherichia albertii strain BIA_7 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PS049_RS10260 | Protein ID | WP_273820272.1 |
Coordinates | 2122014..2122418 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PS049_RS10255 | Protein ID | WP_000354046.1 |
Coordinates | 2121767..2122033 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS049_RS10235 (2117477) | 2117477..2118910 | - | 1434 | WP_025238420.1 | 6-phospho-beta-glucosidase BglA | - |
PS049_RS10240 (2118955) | 2118955..2119266 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
PS049_RS10245 (2119434) | 2119434..2120093 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
PS049_RS10250 (2120534) | 2120534..2121514 | - | 981 | WP_273820270.1 | tRNA-modifying protein YgfZ | - |
PS049_RS10255 (2121767) | 2121767..2122033 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PS049_RS10260 (2122014) | 2122014..2122418 | + | 405 | WP_273820272.1 | protein YgfX | Toxin |
PS049_RS10265 (2122457) | 2122457..2122978 | - | 522 | WP_273783070.1 | flavodoxin FldB | - |
PS049_RS10270 (2123090) | 2123090..2123986 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PS049_RS10275 (2124011) | 2124011..2124721 | + | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PS049_RS10280 (2124727) | 2124727..2126460 | + | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15918.84 Da Isoelectric Point: 11.1732
>T271402 WP_273820272.1 NZ_CP117562:2122014-2122418 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVTAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVTAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |