Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1884791..1885626 | Replicon | chromosome |
| Accession | NZ_CP117562 | ||
| Organism | Escherichia albertii strain BIA_7 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J5ZPW7 |
| Locus tag | PS049_RS09165 | Protein ID | WP_000854722.1 |
| Coordinates | 1885249..1885626 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PS049_RS09160 | Protein ID | WP_273820222.1 |
| Coordinates | 1884791..1885159 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS049_RS09130 (1881355) | 1881355..1881550 | + | 196 | Protein_1770 | DUF905 family protein | - |
| PS049_RS09135 (1881667) | 1881667..1882485 | + | 819 | WP_075362641.1 | DUF932 domain-containing protein | - |
| PS049_RS09140 (1882827) | 1882827..1883300 | + | 474 | WP_075362640.1 | antirestriction protein | - |
| PS049_RS09145 (1883316) | 1883316..1883792 | + | 477 | WP_001186770.1 | RadC family protein | - |
| PS049_RS09150 (1883861) | 1883861..1884082 | + | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| PS049_RS09155 (1884097) | 1884097..1884741 | + | 645 | Protein_1775 | antitoxin of toxin-antitoxin stability system | - |
| PS049_RS09160 (1884791) | 1884791..1885159 | + | 369 | WP_273820222.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PS049_RS09165 (1885249) | 1885249..1885626 | + | 378 | WP_000854722.1 | TA system toxin CbtA family protein | Toxin |
| PS049_RS09170 (1885623) | 1885623..1886111 | + | 489 | WP_074463758.1 | DUF5983 family protein | - |
| PS049_RS09175 (1886131) | 1886131..1886328 | + | 198 | WP_000445281.1 | DUF957 domain-containing protein | - |
| PS049_RS09180 (1886413) | 1886413..1887258 | + | 846 | WP_001280427.1 | DUF4942 domain-containing protein | - |
| PS049_RS09190 (1887559) | 1887559..1888065 | + | 507 | WP_000245810.1 | G/U mismatch-specific DNA glycosylase | - |
| PS049_RS09195 (1888145) | 1888145..1889986 | - | 1842 | WP_113623110.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14103.15 Da Isoelectric Point: 8.2904
>T271401 WP_000854722.1 NZ_CP117562:1885249-1885626 [Escherichia albertii]
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13633.38 Da Isoelectric Point: 6.3159
>AT271401 WP_273820222.1 NZ_CP117562:1884791-1885159 [Escherichia albertii]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLEFMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLEFMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|