Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 29688..30213 | Replicon | plasmid pEA8_1 |
| Accession | NZ_CP117559 | ||
| Organism | Escherichia albertii strain BIA_8 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | PS052_RS23325 | Protein ID | WP_001159868.1 |
| Coordinates | 29908..30213 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | PS052_RS23320 | Protein ID | WP_000813634.1 |
| Coordinates | 29688..29906 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS052_RS23290 (25014) | 25014..25231 | + | 218 | Protein_19 | transposase | - |
| PS052_RS23295 (25287) | 25287..25603 | - | 317 | Protein_20 | type II toxin-antitoxin system VapC family toxin | - |
| PS052_RS23300 (25790) | 25790..26977 | - | 1188 | WP_273765785.1 | IS91 family transposase | - |
| PS052_RS23305 (26977) | 26977..27273 | - | 297 | WP_059225599.1 | hypothetical protein | - |
| PS052_RS23310 (27432) | 27432..27659 | - | 228 | Protein_23 | type II toxin-antitoxin system VapB family antitoxin | - |
| PS052_RS23315 (27858) | 27858..29207 | - | 1350 | WP_243043965.1 | hypothetical protein | - |
| PS052_RS23320 (29688) | 29688..29906 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| PS052_RS23325 (29908) | 29908..30213 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| PS052_RS23330 (30214) | 30214..30357 | + | 144 | Protein_27 | hypothetical protein | - |
| PS052_RS23335 (30457) | 30457..31629 | + | 1173 | WP_053264206.1 | IS21-like element IS21 family transposase | - |
| PS052_RS23340 (31629) | 31629..32426 | + | 798 | WP_273764657.1 | IS21-like element IS21 family helper ATPase IstB | - |
| PS052_RS23345 (32486) | 32486..33154 | + | 669 | Protein_30 | site-specific integrase | - |
| PS052_RS23350 (33876) | 33876..34631 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..108071 | 108071 | |
| - | inside | IScluster/Tn | - | - | 14528..32426 | 17898 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T271383 WP_001159868.1 NZ_CP117559:29908-30213 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|