Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
Location | 24210..25013 | Replicon | plasmid pEA8_1 |
Accession | NZ_CP117559 | ||
Organism | Escherichia albertii strain BIA_8 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A8S7IG51 |
Locus tag | PS052_RS23285 | Protein ID | WP_053285705.1 |
Coordinates | 24483..25013 (+) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | G3CAI7 |
Locus tag | PS052_RS23280 | Protein ID | WP_001275013.1 |
Coordinates | 24210..24479 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS052_RS23255 (19624) | 19624..20020 | + | 397 | Protein_12 | IS481 family transposase | - |
PS052_RS23260 (20526) | 20526..21161 | + | 636 | WP_074458670.1 | T3SS effector NleG family protein | - |
PS052_RS23265 (21299) | 21299..21635 | + | 337 | Protein_14 | IS630 family transposase | - |
PS052_RS23270 (21718) | 21718..22083 | + | 366 | WP_024223721.1 | hypothetical protein | - |
PS052_RS23275 (22083) | 22083..23270 | + | 1188 | WP_187183929.1 | IS91 family transposase | - |
PS052_RS23280 (24210) | 24210..24479 | + | 270 | WP_001275013.1 | DUF1778 domain-containing protein | Antitoxin |
PS052_RS23285 (24483) | 24483..25013 | + | 531 | WP_053285705.1 | GNAT family N-acetyltransferase | Toxin |
PS052_RS23290 (25014) | 25014..25231 | + | 218 | Protein_19 | transposase | - |
PS052_RS23295 (25287) | 25287..25603 | - | 317 | Protein_20 | type II toxin-antitoxin system VapC family toxin | - |
PS052_RS23300 (25790) | 25790..26977 | - | 1188 | WP_273765785.1 | IS91 family transposase | - |
PS052_RS23305 (26977) | 26977..27273 | - | 297 | WP_059225599.1 | hypothetical protein | - |
PS052_RS23310 (27432) | 27432..27659 | - | 228 | Protein_23 | type II toxin-antitoxin system VapB family antitoxin | - |
PS052_RS23315 (27858) | 27858..29207 | - | 1350 | WP_243043965.1 | hypothetical protein | - |
PS052_RS23320 (29688) | 29688..29906 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..108071 | 108071 | |
- | inside | IScluster/Tn | - | - | 14528..32426 | 17898 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20291.22 Da Isoelectric Point: 6.7483
>T271382 WP_053285705.1 NZ_CP117559:24483-25013 [Escherichia albertii]
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKVENCDSL
FYPTKSIEVLFEVNDE
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKVENCDSL
FYPTKSIEVLFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|