Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4499723..4500339 Replicon chromosome
Accession NZ_CP117558
Organism Escherichia albertii strain BIA_8

Toxin (Protein)


Gene name vapC Uniprot ID A0A8D9PNC1
Locus tag PS052_RS22155 Protein ID WP_044713737.1
Coordinates 4499723..4500097 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PS052_RS22160 Protein ID WP_103054107.1
Coordinates 4500097..4500339 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS052_RS22140 (4497226) 4497226..4498128 + 903 WP_059225175.1 formate dehydrogenase O subunit beta -
PS052_RS22145 (4498125) 4498125..4498760 + 636 WP_000829019.1 formate dehydrogenase cytochrome b556 subunit -
PS052_RS22150 (4498757) 4498757..4499686 + 930 WP_000027704.1 formate dehydrogenase accessory protein FdhE -
PS052_RS22155 (4499723) 4499723..4500097 - 375 WP_044713737.1 type II toxin-antitoxin system VapC family toxin Toxin
PS052_RS22160 (4500097) 4500097..4500339 - 243 WP_103054107.1 CopG family transcriptional regulator Antitoxin
PS052_RS22165 (4500567) 4500567..4500785 - 219 WP_001314326.1 CopG family transcriptional regulator -
PS052_RS22170 (4501184) 4501184..4501462 - 279 WP_103054106.1 hypothetical protein -
PS052_RS22175 (4501524) 4501524..4501736 - 213 WP_103054105.1 hypothetical protein -
PS052_RS22180 (4501821) 4501821..4501886 - 66 Protein_4333 transcriptional regulator -
PS052_RS22185 (4501904) 4501904..4502845 - 942 WP_001297068.1 fatty acid biosynthesis protein FabY -
PS052_RS22190 (4502890) 4502890..4503327 - 438 WP_000560977.1 D-aminoacyl-tRNA deacylase -
PS052_RS22195 (4503324) 4503324..4504196 - 873 WP_000916663.1 virulence factor BrkB family protein -
PS052_RS22200 (4504190) 4504190..4504789 - 600 WP_002460585.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(15-48)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13940.21 Da        Isoelectric Point: 9.4803

>T271381 WP_044713737.1 NZ_CP117558:c4500097-4499723 [Escherichia albertii]
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLAGAKKYNQEHRIRIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVITPYQP

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9272.61 Da        Isoelectric Point: 4.4819

>AT271381 WP_103054107.1 NZ_CP117558:c4500339-4500097 [Escherichia albertii]
MSAMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVAQYLENQSKTTIFSALGIWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References