Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3496910..3497528 | Replicon | chromosome |
Accession | NZ_CP117558 | ||
Organism | Escherichia albertii strain BIA_8 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PS052_RS17415 | Protein ID | WP_001280991.1 |
Coordinates | 3497310..3497528 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B1EKM5 |
Locus tag | PS052_RS17410 | Protein ID | WP_000344798.1 |
Coordinates | 3496910..3497284 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS052_RS17400 (3491990) | 3491990..3493183 | + | 1194 | WP_273764923.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PS052_RS17405 (3493206) | 3493206..3496355 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
PS052_RS17410 (3496910) | 3496910..3497284 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
PS052_RS17415 (3497310) | 3497310..3497528 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PS052_RS17420 (3497705) | 3497705..3498262 | + | 558 | WP_000093561.1 | maltose O-acetyltransferase | - |
PS052_RS17425 (3498370) | 3498370..3498840 | + | 471 | WP_273764927.1 | YlaC family protein | - |
PS052_RS17430 (3499004) | 3499004..3500554 | + | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
PS052_RS17435 (3500592) | 3500592..3500945 | - | 354 | WP_273764929.1 | DUF1428 family protein | - |
PS052_RS17445 (3501326) | 3501326..3501637 | + | 312 | WP_000409915.1 | MGMT family protein | - |
PS052_RS17450 (3501667) | 3501667..3502239 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271375 WP_001280991.1 NZ_CP117558:3497310-3497528 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271375 WP_000344798.1 NZ_CP117558:3496910-3497284 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|