Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 2879268..2879740 Replicon chromosome
Accession NZ_CP117558
Organism Escherichia albertii strain BIA_8

Toxin (Protein)


Gene name parE_1 Uniprot ID -
Locus tag PS052_RS14375 Protein ID WP_042898926.1
Coordinates 2879459..2879740 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID -
Locus tag PS052_RS14370 Protein ID WP_001090452.1
Coordinates 2879268..2879459 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS052_RS14315 (2874352) 2874352..2875029 - 678 WP_244510491.1 hypothetical protein -
PS052_RS14320 (2875030) 2875030..2875161 - 132 Protein_2809 hypothetical protein -
PS052_RS14325 (2875158) 2875158..2875367 - 210 WP_000951707.1 hypothetical protein -
PS052_RS14330 (2875369) 2875369..2875926 - 558 WP_000014353.1 ead/Ea22-like family protein -
PS052_RS14335 (2875923) 2875923..2876099 - 177 WP_000753067.1 hypothetical protein -
PS052_RS14340 (2876092) 2876092..2876274 - 183 WP_001224672.1 hypothetical protein -
PS052_RS14345 (2876423) 2876423..2876845 - 423 WP_001151248.1 DUF977 family protein -
PS052_RS14350 (2876886) 2876886..2877962 - 1077 WP_001262417.1 hypothetical protein -
PS052_RS14355 (2878034) 2878034..2878459 - 426 WP_000693841.1 toxin YdaT family protein -
PS052_RS14360 (2878456) 2878456..2878722 - 267 WP_074404412.1 YdaS family helix-turn-helix protein -
PS052_RS14365 (2878839) 2878839..2879237 + 399 WP_000209118.1 helix-turn-helix domain-containing protein -
PS052_RS14370 (2879268) 2879268..2879459 + 192 WP_001090452.1 hypothetical protein Antitoxin
PS052_RS14375 (2879459) 2879459..2879740 + 282 WP_042898926.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PS052_RS14380 (2880084) 2880084..2880383 + 300 WP_044705881.1 hypothetical protein -
PS052_RS14385 (2880455) 2880455..2880673 + 219 WP_001171942.1 protein YdfC -
PS052_RS14390 (2880696) 2880696..2881103 + 408 WP_000394520.1 hypothetical protein -
PS052_RS14395 (2881081) 2881081..2881314 - 234 WP_273764722.1 hypothetical protein -
PS052_RS14400 (2881880) 2881880..2882101 + 222 WP_000560212.1 cell division protein FtsZ -
PS052_RS14405 (2882225) 2882225..2884705 + 2481 WP_273764770.1 exonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2842700..2887079 44379


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10719.56 Da        Isoelectric Point: 10.1409

>T271374 WP_042898926.1 NZ_CP117558:2879459-2879740 [Escherichia albertii]
MLPILWLPSARDDLRQIVAYIAKENLHAARRLKIRIETCVLALSEHPYLYPSSDRVSGLREIVAHPNYIILYRVATSSIE
IVSVAHARRQFPR

Download         Length: 282 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 6885.65 Da        Isoelectric Point: 3.9389

>AT271374 WP_001090452.1 NZ_CP117558:2879268-2879459 [Escherichia albertii]
MNTALSPIVSEFETIEQENSYNEWLRTKVAASLADPRPAIPHDEAMAEIENLIAQISATNGSV

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References