Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 890596..891247 | Replicon | chromosome |
| Accession | NZ_CP117558 | ||
| Organism | Escherichia albertii strain BIA_8 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A8D9PM36 |
| Locus tag | PS052_RS04410 | Protein ID | WP_044714929.1 |
| Coordinates | 890843..891247 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PS052_RS04405 | Protein ID | WP_000354046.1 |
| Coordinates | 890596..890862 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS052_RS04380 (886308) | 886308..887741 | - | 1434 | WP_273765305.1 | 6-phospho-beta-glucosidase BglA | - |
| PS052_RS04385 (887786) | 887786..888097 | + | 312 | WP_001182937.1 | N(4)-acetylcytidine aminohydrolase | - |
| PS052_RS04390 (888265) | 888265..888924 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
| PS052_RS04395 (889364) | 889364..890344 | - | 981 | WP_103053871.1 | tRNA-modifying protein YgfZ | - |
| PS052_RS04400 (890376) | 890376..890606 | + | 231 | WP_273765308.1 | hypothetical protein | - |
| PS052_RS04405 (890596) | 890596..890862 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PS052_RS04410 (890843) | 890843..891247 | + | 405 | WP_044714929.1 | protein YgfX | Toxin |
| PS052_RS04415 (891286) | 891286..891807 | - | 522 | WP_103053870.1 | flavodoxin FldB | - |
| PS052_RS04420 (891919) | 891919..892815 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PS052_RS04425 (892840) | 892840..893550 | + | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PS052_RS04430 (893556) | 893556..895289 | + | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15835.76 Da Isoelectric Point: 10.2082
>T271366 WP_044714929.1 NZ_CP117558:890843-891247 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLCLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLCLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |