Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4526165..4526760 | Replicon | chromosome |
Accession | NZ_CP117556 | ||
Organism | Escherichia albertii strain BIA_89-5 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | - |
Locus tag | PS032_RS22705 | Protein ID | WP_059255551.1 |
Coordinates | 4526165..4526515 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | - |
Locus tag | PS032_RS22710 | Protein ID | WP_059255553.1 |
Coordinates | 4526509..4526760 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS032_RS22685 (4521770) | 4521770..4522738 | + | 969 | WP_137650502.1 | PfkB family carbohydrate kinase | - |
PS032_RS22690 (4522791) | 4522791..4524134 | + | 1344 | WP_273806757.1 | sugar porter family MFS transporter | - |
PS032_RS22695 (4524220) | 4524220..4524720 | + | 501 | WP_059255546.1 | D-ribose pyranase | - |
PS032_RS22700 (4524733) | 4524733..4526112 | + | 1380 | WP_137650500.1 | sugar porter family MFS transporter | - |
PS032_RS22705 (4526165) | 4526165..4526515 | - | 351 | WP_059255551.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
PS032_RS22710 (4526509) | 4526509..4526760 | - | 252 | WP_059255553.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PS032_RS22715 (4526969) | 4526969..4527313 | - | 345 | WP_001219163.1 | gamma-glutamylcyclotransferase | - |
PS032_RS22720 (4527316) | 4527316..4531095 | - | 3780 | WP_137650499.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12631.65 Da Isoelectric Point: 5.1420
>T271357 WP_059255551.1 NZ_CP117556:c4526515-4526165 [Escherichia albertii]
MVKRSEFERGDIMLVGFDPASGHEQRGAGRPVLVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLRCEEGDVCGVVVV
NQVRMMDLNARQAKRIGLACDEVVEEVLLRLQAVVE
MVKRSEFERGDIMLVGFDPASGHEQRGAGRPVLVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLRCEEGDVCGVVVV
NQVRMMDLNARQAKRIGLACDEVVEEVLLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|