Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 2510880..2511481 | Replicon | chromosome |
Accession | NZ_CP117556 | ||
Organism | Escherichia albertii strain BIA_89-5 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | PS032_RS12525 | Protein ID | WP_137650472.1 |
Coordinates | 2510880..2511263 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | B1ELZ9 |
Locus tag | PS032_RS12530 | Protein ID | WP_001195490.1 |
Coordinates | 2511260..2511481 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS032_RS12510 (2506286) | 2506286..2507969 | - | 1684 | Protein_2453 | sulfatase | - |
PS032_RS12515 (2508340) | 2508340..2509376 | - | 1037 | Protein_2454 | IS3 family transposase | - |
PS032_RS12520 (2509381) | 2509381..2510938 | + | 1558 | Protein_2455 | autotransporter outer membrane beta-barrel domain-containing protein | - |
PS032_RS12525 (2510880) | 2510880..2511263 | - | 384 | WP_137650472.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PS032_RS12530 (2511260) | 2511260..2511481 | - | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PS032_RS12535 (2511887) | 2511887..2512282 | + | 396 | WP_137650473.1 | trans-aconitate 2-methyltransferase | - |
PS032_RS12540 (2512286) | 2512286..2513200 | - | 915 | WP_024164792.1 | bestrophin family protein | - |
PS032_RS12545 (2513405) | 2513405..2514856 | - | 1452 | WP_105197997.1 | tagaturonate reductase | - |
PS032_RS12550 (2515103) | 2515103..2516390 | - | 1288 | Protein_2461 | diguanylate cyclase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2508340..2509245 | 905 | |
- | inside | Prophage | - | stx2B / stx2A | 2508340..2605101 | 96761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14416.47 Da Isoelectric Point: 9.5855
>T271346 WP_137650472.1 NZ_CP117556:c2511263-2510880 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MAFLWRNGIRIRDVDNSLENLTVEAATGEVSPLRRYAIRPDGGFLRG
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MAFLWRNGIRIRDVDNSLENLTVEAATGEVSPLRRYAIRPDGGFLRG
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|