271344

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 2362877..2363349 Replicon chromosome
Accession NZ_CP117556
Organism Escherichia albertii strain BIA_89-5

Toxin (Protein)


Gene name parE_1 Uniprot ID -
Locus tag PS032_RS11770 Protein ID WP_042898926.1
Coordinates 2362877..2363158 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID -
Locus tag PS032_RS11775 Protein ID WP_001090452.1
Coordinates 2363158..2363349 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS032_RS11745 (2360185) 2360185..2360460 - 276 WP_044805262.1 hypothetical protein -
PS032_RS11750 (2360596) 2360596..2360817 - 222 WP_062898151.1 cell division protein FtsZ -
PS032_RS11755 (2360864) 2360864..2361715 - 852 WP_137650430.1 Rha family phage regulatory protein -
PS032_RS11760 (2362221) 2362221..2362415 + 195 WP_074464194.1 hypothetical protein -
PS032_RS11765 (2362381) 2362381..2362599 - 219 WP_000232638.1 hypothetical protein -
PS032_RS11770 (2362877) 2362877..2363158 - 282 WP_042898926.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PS032_RS11775 (2363158) 2363158..2363349 - 192 WP_001090452.1 hypothetical protein Antitoxin
PS032_RS11780 (2363380) 2363380..2363778 - 399 WP_000209118.1 helix-turn-helix domain-containing protein -
PS032_RS11785 (2363895) 2363895..2364161 + 267 WP_074404412.1 YdaS family helix-turn-helix protein -
PS032_RS11790 (2364158) 2364158..2364583 + 426 WP_149452502.1 toxin YdaT family protein -
PS032_RS11795 (2364655) 2364655..2365695 + 1041 WP_137650431.1 DnaT-like ssDNA-binding domain-containing protein -
PS032_RS11800 (2365688) 2365688..2366149 + 462 WP_262409891.1 replication protein P -
PS032_RS11805 (2366182) 2366182..2366924 + 743 Protein_2312 DUF1627 domain-containing protein -
PS032_RS11810 (2366911) 2366911..2367117 + 207 WP_053893343.1 hypothetical protein -
PS032_RS11815 (2367114) 2367114..2367368 + 255 WP_001294161.1 hypothetical protein -
PS032_RS11820 (2367361) 2367361..2367492 + 132 Protein_2315 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2354664..2398461 43797
- flank IS/Tn - - 2367498..2368538 1040


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10719.56 Da        Isoelectric Point: 10.1409

>T271344 WP_042898926.1 NZ_CP117556:c2363158-2362877 [Escherichia albertii]
MLPILWLPSARDDLRQIVAYIAKENLHAARRLKIRIETCVLALSEHPYLYPSSDRVSGLREIVAHPNYIILYRVATSSIE
IVSVAHARRQFPR

Download         Length: 282 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 6885.65 Da        Isoelectric Point: 3.9389

>AT271344 WP_001090452.1 NZ_CP117556:c2363349-2363158 [Escherichia albertii]
MNTALSPIVSEFETIEQENSYNEWLRTKVAASLADPRPAIPHDEAMAEIENLIAQISATNGSV

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References