Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1991316..1992142 | Replicon | chromosome |
Accession | NZ_CP117556 | ||
Organism | Escherichia albertii strain BIA_89-5 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | PS032_RS09795 | Protein ID | WP_137649856.1 |
Coordinates | 1991765..1992142 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | PS032_RS09790 | Protein ID | WP_137649884.1 |
Coordinates | 1991316..1991675 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS032_RS09760 (1988110) | 1988110..1988305 | + | 196 | Protein_1913 | DUF905 family protein | - |
PS032_RS09765 (1988422) | 1988422..1989240 | + | 819 | WP_137649855.1 | DUF932 domain-containing protein | - |
PS032_RS09770 (1989331) | 1989331..1989816 | + | 486 | WP_000214315.1 | antirestriction protein | - |
PS032_RS09775 (1989832) | 1989832..1990308 | + | 477 | WP_001186725.1 | RadC family protein | - |
PS032_RS09780 (1990377) | 1990377..1990598 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
PS032_RS09785 (1990613) | 1990613..1991257 | + | 645 | Protein_1918 | antitoxin of toxin-antitoxin stability system | - |
PS032_RS09790 (1991316) | 1991316..1991675 | + | 360 | WP_137649884.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PS032_RS09795 (1991765) | 1991765..1992142 | + | 378 | WP_137649856.1 | TA system toxin CbtA family protein | Toxin |
PS032_RS09800 (1992139) | 1992139..1992627 | + | 489 | Protein_1921 | DUF5983 family protein | - |
PS032_RS09805 (1992647) | 1992647..1992844 | + | 198 | WP_063082310.1 | DUF957 domain-containing protein | - |
PS032_RS09810 (1992941) | 1992941..1993783 | + | 843 | WP_063082311.1 | DUF4942 domain-containing protein | - |
PS032_RS09820 (1994254) | 1994254..1995192 | + | 939 | WP_059224874.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
PS032_RS09825 (1995264) | 1995264..1996001 | + | 738 | WP_000283677.1 | phosphatase | - |
PS032_RS09830 (1996025) | 1996025..1996579 | + | 555 | WP_001001899.1 | molecular chaperone YcdY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14107.06 Da Isoelectric Point: 7.1881
>T271340 WP_137649856.1 NZ_CP117556:1991765-1992142 [Escherichia albertii]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQYIEAGISLCDAVNFLVEKYALVRTDQPGF
SACARSQLINSIDILRACRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQYIEAGISLCDAVNFLVEKYALVRTDQPGF
SACARSQLINSIDILRACRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13589.42 Da Isoelectric Point: 6.6260
>AT271340 WP_137649884.1 NZ_CP117556:1991316-1991675 [Escherichia albertii]
MFHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQVFPLLMKQLELMLTSGELN
PRHQHTVTLYAKGVTCEADTLGSCGYVYLAVYPTPETKK
MFHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQVFPLLMKQLELMLTSGELN
PRHQHTVTLYAKGVTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|