Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1980913..1981538 | Replicon | chromosome |
| Accession | NZ_CP117556 | ||
| Organism | Escherichia albertii strain BIA_89-5 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PS032_RS09730 | Protein ID | WP_000911314.1 |
| Coordinates | 1980913..1981311 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PS032_RS09735 | Protein ID | WP_273807068.1 |
| Coordinates | 1981311..1981538 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS032_RS09710 (1976377) | 1976377..1976862 | + | 486 | WP_000605865.1 | hypothetical protein | - |
| PS032_RS09715 (1976911) | 1976911..1977642 | + | 732 | WP_000782451.1 | conjugal transfer complement resistance protein TraT | - |
| PS032_RS09720 (1977846) | 1977846..1978325 | + | 480 | WP_001382783.1 | hypothetical protein | - |
| PS032_RS09725 (1978607) | 1978607..1980904 | + | 2298 | WP_273807067.1 | type IV conjugative transfer system coupling protein TraD | - |
| PS032_RS09730 (1980913) | 1980913..1981311 | - | 399 | WP_000911314.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PS032_RS09735 (1981311) | 1981311..1981538 | - | 228 | WP_273807068.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PS032_RS09740 (1981620) | 1981620..1982948 | + | 1329 | Protein_1909 | MobF family relaxase | - |
| PS032_RS09745 (1983040) | 1983040..1984212 | + | 1173 | WP_053264206.1 | IS21-like element IS21 family transposase | - |
| PS032_RS09750 (1984212) | 1984212..1985009 | + | 798 | WP_123012753.1 | IS21-like element IS21 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1977714..1991675 | 13961 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14814.12 Da Isoelectric Point: 7.8604
>T271339 WP_000911314.1 NZ_CP117556:c1981311-1980913 [Escherichia albertii]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|