Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 1953346..1953871 Replicon chromosome
Accession NZ_CP117556
Organism Escherichia albertii strain BIA_89-5

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag PS032_RS09570 Protein ID WP_001159871.1
Coordinates 1953346..1953651 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag PS032_RS09575 Protein ID WP_000813639.1
Coordinates 1953653..1953871 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS032_RS09540 (1948609) 1948609..1949043 + 435 WP_122989639.1 transposase -
PS032_RS09545 (1949040) 1949040..1949390 + 351 WP_089572268.1 IS66 family insertion sequence element accessory protein TnpB -
PS032_RS09550 (1949421) 1949421..1951013 + 1593 WP_137650637.1 IS66 family transposase -
PS032_RS09555 (1951145) 1951145..1951960 + 816 WP_137650563.1 lipid II-degrading bacteriocin colicin M -
PS032_RS09560 (1952010) 1952010..1952363 - 354 WP_000864816.1 colicin M immunity protein -
PS032_RS09565 (1952536) 1952536..1953345 - 810 WP_000016972.1 site-specific integrase -
PS032_RS09570 (1953346) 1953346..1953651 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
PS032_RS09575 (1953653) 1953653..1953871 - 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PS032_RS09580 (1954310) 1954310..1954654 + 345 WP_273807064.1 fimbrial protein -
PS032_RS09585 (1954729) 1954729..1955433 + 705 Protein_1878 molecular chaperone -
PS032_RS09590 (1955390) 1955390..1955857 + 468 WP_249935638.1 fimbria/pilus periplasmic chaperone -
PS032_RS09595 (1955886) 1955886..1958393 + 2508 WP_137650526.1 fimbria/pilus outer membrane usher protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1951145..1963194 12049
- inside Genomic island - - 1951145..1964980 13835


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T271338 WP_001159871.1 NZ_CP117556:c1953651-1953346 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT271338 WP_000813639.1 NZ_CP117556:c1953871-1953653 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References