Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1365119..1365737 | Replicon | chromosome |
| Accession | NZ_CP117556 | ||
| Organism | Escherichia albertii strain BIA_89-5 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS032_RS06770 | Protein ID | WP_001280991.1 |
| Coordinates | 1365119..1365337 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS032_RS06775 | Protein ID | WP_000344798.1 |
| Coordinates | 1365363..1365737 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS032_RS06735 (1360408) | 1360408..1360980 | + | 573 | WP_113622884.1 | YbaY family lipoprotein | - |
| PS032_RS06740 (1361010) | 1361010..1361321 | - | 312 | WP_000409915.1 | MGMT family protein | - |
| PS032_RS06750 (1361702) | 1361702..1362055 | + | 354 | WP_137649645.1 | DUF1428 family protein | - |
| PS032_RS06755 (1362093) | 1362093..1363643 | - | 1551 | WP_137649644.1 | EAL domain-containing protein | - |
| PS032_RS06760 (1363807) | 1363807..1364277 | - | 471 | WP_000136189.1 | YlaC family protein | - |
| PS032_RS06765 (1364385) | 1364385..1364942 | - | 558 | WP_000093562.1 | maltose O-acetyltransferase | - |
| PS032_RS06770 (1365119) | 1365119..1365337 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS032_RS06775 (1365363) | 1365363..1365737 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS032_RS06780 (1366292) | 1366292..1369441 | - | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS032_RS06785 (1369464) | 1369464..1370657 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271337 WP_001280991.1 NZ_CP117556:c1365337-1365119 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271337 WP_000344798.1 NZ_CP117556:c1365737-1365363 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|