Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1024394..1025045 | Replicon | chromosome |
| Accession | NZ_CP117556 | ||
| Organism | Escherichia albertii strain BIA_89-5 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B1EG01 |
| Locus tag | PS032_RS05100 | Protein ID | WP_000244763.1 |
| Coordinates | 1024641..1025045 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PS032_RS05095 | Protein ID | WP_000354046.1 |
| Coordinates | 1024394..1024660 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS032_RS05065 (1019403) | 1019403..1020296 | + | 894 | WP_059214571.1 | transporter | - |
| PS032_RS05070 (1020344) | 1020344..1021777 | - | 1434 | WP_024164724.1 | 6-phospho-beta-glucosidase BglA | - |
| PS032_RS05075 (1021822) | 1021822..1022133 | + | 312 | WP_137649989.1 | N(4)-acetylcytidine aminohydrolase | - |
| PS032_RS05080 (1022301) | 1022301..1022960 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
| PS032_RS05085 (1023162) | 1023162..1024142 | - | 981 | WP_137649988.1 | tRNA-modifying protein YgfZ | - |
| PS032_RS05090 (1024174) | 1024174..1024404 | + | 231 | WP_000181267.1 | hypothetical protein | - |
| PS032_RS05095 (1024394) | 1024394..1024660 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PS032_RS05100 (1024641) | 1024641..1025045 | + | 405 | WP_000244763.1 | protein YgfX | Toxin |
| PS032_RS05105 (1025084) | 1025084..1025605 | - | 522 | WP_085456580.1 | flavodoxin FldB | - |
| PS032_RS05110 (1025717) | 1025717..1026613 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PS032_RS05115 (1026638) | 1026638..1027348 | + | 711 | WP_000748105.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PS032_RS05120 (1027354) | 1027354..1029087 | + | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271336 WP_000244763.1 NZ_CP117556:1024641-1025045 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6P9B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |