Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 749761..750596 | Replicon | chromosome |
Accession | NZ_CP117556 | ||
Organism | Escherichia albertii strain BIA_89-5 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | PS032_RS03810 | Protein ID | WP_074463759.1 |
Coordinates | 750219..750596 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | PS032_RS03805 | Protein ID | WP_042857085.1 |
Coordinates | 749761..750129 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS032_RS03775 (745647) | 745647..746132 | + | 486 | WP_137650660.1 | antirestriction protein | - |
PS032_RS03780 (746306) | 746306..747478 | + | 1173 | WP_053264206.1 | IS21-like element IS21 family transposase | - |
PS032_RS03785 (747478) | 747478..748275 | + | 798 | WP_123012753.1 | IS21-like element IS21 family helper ATPase IstB | - |
PS032_RS03790 (748336) | 748336..748758 | + | 423 | WP_042634583.1 | RadC family protein | - |
PS032_RS03795 (748827) | 748827..749048 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
PS032_RS03800 (749067) | 749067..749711 | + | 645 | WP_137650491.1 | antitoxin of toxin-antitoxin stability system | - |
PS032_RS03805 (749761) | 749761..750129 | + | 369 | WP_042857085.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PS032_RS03810 (750219) | 750219..750596 | + | 378 | WP_074463759.1 | TA system toxin CbtA family protein | Toxin |
PS032_RS03815 (750593) | 750593..751081 | + | 489 | WP_000761676.1 | DUF5983 family protein | - |
PS032_RS03820 (751093) | 751093..751290 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
PS032_RS03825 (751375) | 751375..752217 | + | 843 | WP_042857090.1 | DUF4942 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 737148..761559 | 24411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14065.14 Da Isoelectric Point: 8.2830
>T271335 WP_074463759.1 NZ_CP117556:750219-750596 [Escherichia albertii]
MKTLPDTLVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTLVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13805.52 Da Isoelectric Point: 5.5089
>AT271335 WP_042857085.1 NZ_CP117556:749761-750129 [Escherichia albertii]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|