Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ataRT/DUF1778(antitoxin)
Location 289130..289930 Replicon chromosome
Accession NZ_CP117556
Organism Escherichia albertii strain BIA_89-5

Toxin (Protein)


Gene name ataT Uniprot ID A0A8H9C5V7
Locus tag PS032_RS01365 Protein ID WP_000342455.1
Coordinates 289403..289930 (+) Length 176 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID B1EHP0
Locus tag PS032_RS01360 Protein ID WP_001277106.1
Coordinates 289130..289396 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS032_RS01330 (284700) 284700..285002 - 303 WP_273806882.1 PTS sugar transporter subunit IIC -
PS032_RS01335 (284939) 284939..286066 - 1128 WP_273806883.1 IS481 family transposase -
PS032_RS01340 (286081) 286081..286443 - 363 WP_244614525.1 PTS sugar transporter subunit IIC -
PS032_RS01345 (286460) 286460..286945 - 486 WP_000029259.1 PTS sugar transporter subunit IIB -
PS032_RS01350 (286952) 286952..287353 - 402 WP_001071334.1 PTS sugar transporter subunit IIA -
PS032_RS01355 (287877) 287877..288980 + 1104 WP_010319184.1 branched chain amino acid ABC transporter substrate-binding protein LivJ -
PS032_RS01360 (289130) 289130..289396 + 267 WP_001277106.1 type II toxin-antitoxin system antitoxin AtaR Antitoxin
PS032_RS01365 (289403) 289403..289930 + 528 WP_000342455.1 type II toxin-antitoxin system toxin acetyltransferase AtaT Toxin
PS032_RS01370 (289927) 289927..290310 - 384 WP_000778774.1 aspartate 1-decarboxylase autocleavage activator PanM -
PS032_RS01375 (290735) 290735..291844 + 1110 WP_000827693.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PS032_RS01380 (291892) 291892..292818 + 927 WP_001295097.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PS032_RS01385 (292815) 292815..294092 + 1278 WP_273806884.1 branched chain amino acid ABC transporter permease LivM -
PS032_RS01390 (294089) 294089..294856 + 768 WP_044709901.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 284939..286066 1127


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(90-150)

Antitoxin

Vibrio phage ICP1, Orf50

(8-86)


Sequences

Toxin        


Download         Length: 176 a.a.        Molecular weight: 19607.47 Da        Isoelectric Point: 6.6343

>T271331 WP_000342455.1 NZ_CP117556:289403-289930 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD

Download         Length: 528 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9942.37 Da        Isoelectric Point: 10.0863

>AT271331 WP_001277106.1 NZ_CP117556:289130-289396 [Escherichia albertii]
MSAVKKQRIDLRLTDDDKSMIEEAAAISNQSVSQFMLNSASQRAAEVIEQHRRMILNEESWTRVMDALSNPPSPGEKLKR
AAKRLQGM

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7Z8E004

References