Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1898806..1899418 | Replicon | chromosome |
| Accession | NZ_CP117554 | ||
| Organism | Erwinia amylovora strain 99east-3-1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | D2TUP9 |
| Locus tag | PTC76_RS08800 | Protein ID | WP_012906750.1 |
| Coordinates | 1898806..1898985 (+) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | D4I356 |
| Locus tag | PTC76_RS08805 | Protein ID | WP_004157632.1 |
| Coordinates | 1899008..1899418 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC76_RS08780 (PTC76_08780) | 1894364..1895314 | + | 951 | WP_004157624.1 | DUF1471 family protein YdgH | - |
| PTC76_RS08785 (PTC76_08785) | 1895522..1896913 | + | 1392 | WP_004157625.1 | amino acid permease | - |
| PTC76_RS08790 (PTC76_08790) | 1896917..1897381 | - | 465 | WP_004157626.1 | hypothetical protein | - |
| PTC76_RS08795 (PTC76_08795) | 1897558..1898286 | + | 729 | WP_004157629.1 | two-component system response regulator RstA | - |
| PTC76_RS08800 (PTC76_08800) | 1898806..1898985 | + | 180 | WP_012906750.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PTC76_RS08805 (PTC76_08805) | 1899008..1899418 | + | 411 | WP_004157632.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PTC76_RS08810 (PTC76_08810) | 1899474..1900475 | + | 1002 | WP_004157633.1 | acyltransferase | - |
| PTC76_RS08815 (PTC76_08815) | 1901346..1901558 | - | 213 | WP_004157635.1 | hypothetical protein | - |
| PTC76_RS08820 (PTC76_08820) | 1901816..1901989 | - | 174 | WP_004157636.1 | hypothetical protein | - |
| PTC76_RS08825 (PTC76_08825) | 1902084..1902257 | - | 174 | WP_013036045.1 | hypothetical protein | - |
| PTC76_RS08830 (PTC76_08830) | 1902268..1902540 | - | 273 | WP_004157637.1 | hypothetical protein | - |
| PTC76_RS08835 (PTC76_08835) | 1903170..1903760 | + | 591 | WP_223386180.1 | DapH/DapD/GlmU-related protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1892644..1903760 | 11116 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6644.85 Da Isoelectric Point: 10.9132
>T271326 WP_012906750.1 NZ_CP117554:1898806-1898985 [Erwinia amylovora]
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14829.76 Da Isoelectric Point: 4.3623
>AT271326 WP_004157632.1 NZ_CP117554:1899008-1899418 [Erwinia amylovora]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDNYQDAIESAREAIDAHIELLVEDGEAVPEATSVENWLADPDYVGVVWALVD
VDVTRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVIGREKR
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDNYQDAIESAREAIDAHIELLVEDGEAVPEATSVENWLADPDYVGVVWALVD
VDVTRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVIGREKR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D6XDK4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A830ZVY0 |