Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1898806..1899418 Replicon chromosome
Accession NZ_CP117554
Organism Erwinia amylovora strain 99east-3-1

Toxin (Protein)


Gene name hicA Uniprot ID D2TUP9
Locus tag PTC76_RS08800 Protein ID WP_012906750.1
Coordinates 1898806..1898985 (+) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID D4I356
Locus tag PTC76_RS08805 Protein ID WP_004157632.1
Coordinates 1899008..1899418 (+) Length 137 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC76_RS08780 (PTC76_08780) 1894364..1895314 + 951 WP_004157624.1 DUF1471 family protein YdgH -
PTC76_RS08785 (PTC76_08785) 1895522..1896913 + 1392 WP_004157625.1 amino acid permease -
PTC76_RS08790 (PTC76_08790) 1896917..1897381 - 465 WP_004157626.1 hypothetical protein -
PTC76_RS08795 (PTC76_08795) 1897558..1898286 + 729 WP_004157629.1 two-component system response regulator RstA -
PTC76_RS08800 (PTC76_08800) 1898806..1898985 + 180 WP_012906750.1 type II toxin-antitoxin system HicA family toxin Toxin
PTC76_RS08805 (PTC76_08805) 1899008..1899418 + 411 WP_004157632.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PTC76_RS08810 (PTC76_08810) 1899474..1900475 + 1002 WP_004157633.1 acyltransferase -
PTC76_RS08815 (PTC76_08815) 1901346..1901558 - 213 WP_004157635.1 hypothetical protein -
PTC76_RS08820 (PTC76_08820) 1901816..1901989 - 174 WP_004157636.1 hypothetical protein -
PTC76_RS08825 (PTC76_08825) 1902084..1902257 - 174 WP_013036045.1 hypothetical protein -
PTC76_RS08830 (PTC76_08830) 1902268..1902540 - 273 WP_004157637.1 hypothetical protein -
PTC76_RS08835 (PTC76_08835) 1903170..1903760 + 591 WP_223386180.1 DapH/DapD/GlmU-related protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1892644..1903760 11116


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6644.85 Da        Isoelectric Point: 10.9132

>T271326 WP_012906750.1 NZ_CP117554:1898806-1898985 [Erwinia amylovora]
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL

Download         Length: 180 bp

Antitoxin


Download         Length: 137 a.a.        Molecular weight: 14829.76 Da        Isoelectric Point: 4.3623

>AT271326 WP_004157632.1 NZ_CP117554:1899008-1899418 [Erwinia amylovora]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDNYQDAIESAREAIDAHIELLVEDGEAVPEATSVENWLADPDYVGVVWALVD
VDVTRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVIGREKR

Download         Length: 411 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D6XDK4

Antitoxin

Source ID Structure
AlphaFold DB A0A830ZVY0

References