Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 725652..726318 | Replicon | chromosome |
Accession | NZ_CP117554 | ||
Organism | Erwinia amylovora strain 99east-3-1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A830ZTB8 |
Locus tag | PTC76_RS03320 | Protein ID | WP_004161808.1 |
Coordinates | 725899..726318 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | D4HWC2 |
Locus tag | PTC76_RS03315 | Protein ID | WP_004155593.1 |
Coordinates | 725652..725918 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC76_RS03295 (PTC76_03295) | 722125..722854 | + | 730 | Protein_647 | SDR family oxidoreductase | - |
PTC76_RS03300 (PTC76_03300) | 722959..723567 | - | 609 | WP_004155587.1 | HD domain-containing protein | - |
PTC76_RS03305 (PTC76_03305) | 723780..724439 | + | 660 | WP_004155588.1 | hemolysin III family protein | - |
PTC76_RS03310 (PTC76_03310) | 724440..725426 | - | 987 | WP_004155590.1 | tRNA-modifying protein YgfZ | - |
PTC76_RS03315 (PTC76_03315) | 725652..725918 | + | 267 | WP_004155593.1 | FAD assembly factor SdhE | Antitoxin |
PTC76_RS03320 (PTC76_03320) | 725899..726318 | + | 420 | WP_004161808.1 | protein YgfX | Toxin |
PTC76_RS03325 (PTC76_03325) | 726436..726954 | - | 519 | WP_004155596.1 | flavodoxin FldB | - |
PTC76_RS03330 (PTC76_03330) | 727184..728137 | - | 954 | WP_004155597.1 | DMT family transporter | - |
PTC76_RS03335 (PTC76_03335) | 728647..730326 | - | 1680 | WP_004155599.1 | type III effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16366.46 Da Isoelectric Point: 11.9444
>T271323 WP_004161808.1 NZ_CP117554:725899-726318 [Erwinia amylovora]
VVLWQCELRPSRLAQRFSLLLHGAVMLALLLPTWPASSGLVRMLLLVLVLLECIRSRRRIGRRQGDIALLEGHELRWRQR
EWCIISRPWLTGQAILLLLQDTHGQRERLWLFADGMEKRNWRQLRLQLLNSKVQGNGWC
VVLWQCELRPSRLAQRFSLLLHGAVMLALLLPTWPASSGLVRMLLLVLVLLECIRSRRRIGRRQGDIALLEGHELRWRQR
EWCIISRPWLTGQAILLLLQDTHGQRERLWLFADGMEKRNWRQLRLQLLNSKVQGNGWC
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A830ZTB8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A831A3F0 |