Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/PRK09907-MazE |
Location | 215652..216223 | Replicon | chromosome |
Accession | NZ_CP117526 | ||
Organism | Fusobacterium nucleatum strain FNU |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PSR67_RS00995 | Protein ID | WP_273858556.1 |
Coordinates | 215900..216223 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | PSR67_RS00990 | Protein ID | WP_273858555.1 |
Coordinates | 215652..215906 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR67_RS00990 (PSR67_00990) | 215652..215906 | + | 255 | WP_273858555.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PSR67_RS00995 (PSR67_00995) | 215900..216223 | + | 324 | WP_273858556.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PSR67_RS01000 (PSR67_01000) | 216278..217264 | - | 987 | WP_273858557.1 | ABC transporter ATP-binding protein | - |
PSR67_RS01005 (PSR67_01005) | 217245..218030 | - | 786 | WP_273858558.1 | ABC transporter ATP-binding protein | - |
PSR67_RS01010 (PSR67_01010) | 218042..219622 | - | 1581 | WP_273858559.1 | ABC transporter substrate-binding protein | - |
PSR67_RS01015 (PSR67_01015) | 219672..220502 | - | 831 | WP_273858560.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12411.50 Da Isoelectric Point: 6.2368
>T271314 WP_273858556.1 NZ_CP117526:215900-216223 [Fusobacterium nucleatum]
VVKRGDIIIINFNPVKGHEQAGKRPALVISNEKFYKIFKLAVILPITNNTKDFPFHVLLDERTNIKGAILCEHLRTVDLE
ERKYDKIEEIPEDLLEEVLEKVSLIFQ
VVKRGDIIIINFNPVKGHEQAGKRPALVISNEKFYKIFKLAVILPITNNTKDFPFHVLLDERTNIKGAILCEHLRTVDLE
ERKYDKIEEIPEDLLEEVLEKVSLIFQ
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|