Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 49757..50251 Replicon chromosome
Accession NZ_CP117526
Organism Fusobacterium nucleatum strain FNU

Toxin (Protein)


Gene name relE Uniprot ID A0A1E9E7Q7
Locus tag PSR67_RS00235 Protein ID WP_070627338.1
Coordinates 49982..50251 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PSR67_RS00230 Protein ID WP_273858428.1
Coordinates 49757..49981 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PSR67_RS00210 (PSR67_00210) 45077..46144 - 1068 WP_273858425.1 NCS2 family permease -
PSR67_RS00215 (PSR67_00215) 46325..46576 + 252 WP_011016015.1 hypothetical protein -
PSR67_RS00220 (PSR67_00220) 46735..48210 + 1476 WP_273858426.1 cobyric acid synthase -
PSR67_RS00225 (PSR67_00225) 48332..49687 + 1356 WP_273858427.1 sodium:alanine symporter family protein -
PSR67_RS00230 (PSR67_00230) 49757..49981 + 225 WP_273858428.1 DUF6290 family protein Antitoxin
PSR67_RS00235 (PSR67_00235) 49982..50251 + 270 WP_070627338.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PSR67_RS00240 (PSR67_00240) 50317..51774 + 1458 WP_273858429.1 HD domain-containing protein -
PSR67_RS00245 (PSR67_00245) 51794..52354 + 561 WP_273858430.1 TlpA disulfide reductase family protein -
PSR67_RS00250 (PSR67_00250) 52390..52815 - 426 WP_273858431.1 ImmA/IrrE family metallo-endopeptidase -
PSR67_RS00255 (PSR67_00255) 52766..53227 - 462 WP_273858432.1 helix-turn-helix domain-containing protein -
PSR67_RS00260 (PSR67_00260) 53415..53918 + 504 WP_273858433.1 hypothetical protein -
PSR67_RS00265 (PSR67_00265) 54071..54475 + 405 WP_273858434.1 adhesion protein FadA -
PSR67_RS00270 (PSR67_00270) 54489..54977 + 489 WP_273858435.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-88)

Antitoxin

Protein of unknown function DUF6290

(1-72)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10844.89 Da        Isoelectric Point: 10.3203

>T271312 WP_070627338.1 NZ_CP117526:49982-50251 [Fusobacterium nucleatum]
MCKYKVYFDKKIKKDFKKLDKNVLKLLLDWIENNLENIENPRSKGRALLGNLKDYWRYRIGDYRLITKIDDGKLLIIALE
LKHRKKVYE

Download         Length: 270 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8657.96 Da        Isoelectric Point: 4.8839

>AT271312 WP_273858428.1 NZ_CP117526:49757-49981 [Fusobacterium nucleatum]
MSNITLRLTDEERDILNSIAHLYGGKLSTAIKTILFEKIEEDYNLKLIKDFEKREKEDKVELISLSDFRKELGV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1E9E7Q7

Antitoxin

Source ID Structure

References