Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
Location | 851870..852666 | Replicon | chromosome |
Accession | NZ_CP117518 | ||
Organism | Photobacterium sp. GSS17 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A0J1K069 |
Locus tag | PGW97_RS20325 | Protein ID | WP_047885761.1 |
Coordinates | 851870..852400 (-) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A0J1H842 |
Locus tag | PGW97_RS20330 | Protein ID | WP_047885762.1 |
Coordinates | 852397..852666 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGW97_RS20305 | 848365..849258 | - | 894 | WP_273860577.1 | alpha/beta hydrolase | - |
PGW97_RS20310 | 849389..850690 | - | 1302 | WP_107193873.1 | Y-family DNA polymerase | - |
PGW97_RS20315 | 850696..851079 | - | 384 | WP_047886305.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
PGW97_RS20320 | 851366..851776 | + | 411 | WP_047885760.1 | SPOR domain-containing protein | - |
PGW97_RS20325 | 851870..852400 | - | 531 | WP_047885761.1 | GNAT family N-acetyltransferase | Toxin |
PGW97_RS20330 | 852397..852666 | - | 270 | WP_047885762.1 | DUF1778 domain-containing protein | Antitoxin |
PGW97_RS20335 | 852798..854249 | - | 1452 | WP_084712588.1 | MATE family efflux transporter | - |
PGW97_RS20340 | 854425..855402 | + | 978 | WP_207103729.1 | LysR family transcriptional regulator | - |
PGW97_RS20345 | 855446..856378 | - | 933 | WP_273860578.1 | FAD-binding protein | - |
PGW97_RS20350 | 856378..857127 | - | 750 | WP_047885765.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 19877.20 Da Isoelectric Point: 9.6044
>T271310 WP_047885761.1 NZ_CP117518:c852400-851870 [Photobacterium sp. GSS17]
VSWSKTFVELDKHVHDRASFDCGEAELNTFIQTQASKHMQAGISRTMVLPASLPLLNQKWPICAFYSVAPSSIRRETLPV
SLAKKLPNYPIPVFLLAQLAVHREYHGHGLGKVSLIRALKYLWEVNAHMRAYAIVVDCLTPAAEAFYTKYGFQVLCDHNG
RTRMFIPMKTVGQLFS
VSWSKTFVELDKHVHDRASFDCGEAELNTFIQTQASKHMQAGISRTMVLPASLPLLNQKWPICAFYSVAPSSIRRETLPV
SLAKKLPNYPIPVFLLAQLAVHREYHGHGLGKVSLIRALKYLWEVNAHMRAYAIVVDCLTPAAEAFYTKYGFQVLCDHNG
RTRMFIPMKTVGQLFS
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1K069 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1H842 |