Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 94625..95196 Replicon plasmid pNBZ135-optrA-105K
Accession NZ_CP117512
Organism Enterococcus faecalis strain CQNBZ21-135

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag PSC79_RS13945 Protein ID WP_002362432.1
Coordinates 94625..94966 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PSC79_RS13950 Protein ID WP_002362431.1
Coordinates 94966..95196 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PSC79_RS13920 (PSC79_13955) 89642..90334 - 693 WP_033918847.1 Fic family protein -
PSC79_RS13925 (PSC79_13960) 90383..90982 - 600 WP_008382128.1 tyrosine-type recombinase/integrase -
PSC79_RS13935 (PSC79_13970) 92708..93310 - 603 WP_002362434.1 Fic family protein -
PSC79_RS13940 (PSC79_13975) 93575..94513 - 939 WP_002362433.1 hypothetical protein -
PSC79_RS13945 (PSC79_13980) 94625..94966 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PSC79_RS13950 (PSC79_13985) 94966..95196 - 231 WP_002362431.1 hypothetical protein Antitoxin
PSC79_RS13955 (PSC79_13990) 95400..96020 + 621 WP_002367784.1 recombinase family protein -
PSC79_RS13960 (PSC79_13995) 96010..96324 + 315 WP_002367785.1 hypothetical protein -
PSC79_RS13965 (PSC79_14000) 96318..96524 + 207 WP_002367786.1 hypothetical protein -
PSC79_RS13970 (PSC79_14005) 96684..96878 + 195 WP_002367787.1 hypothetical protein -
PSC79_RS13975 (PSC79_14010) 96890..97081 + 192 WP_002367788.1 hypothetical protein -
PSC79_RS13980 (PSC79_14015) 97251..97466 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
PSC79_RS13985 (PSC79_14020) 97467..97808 + 342 WP_002367792.1 bacteriocin immunity protein -
PSC79_RS13990 (PSC79_14025) 98120..99298 + 1179 WP_000997695.1 IS256-like element ISEf1 family transposase -
PSC79_RS13995 (PSC79_14030) 99570..100088 + 519 WP_002367793.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / fexA / optrA / erm(A) / ant(6)-Ia / aph(3')-III / erm(B) / dfrG - 1..105647 105647
- flank IS/Tn erm(B) - 98120..103315 5195


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T271309 WP_002362432.1 NZ_CP117512:c94966-94625 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT271309 WP_002362431.1 NZ_CP117512:c95196-94966 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References