Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 395687..396239 | Replicon | chromosome |
Accession | NZ_CP117511 | ||
Organism | Enterococcus faecalis strain CQNBZ21-135 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | PSC79_RS02020 | Protein ID | WP_002355414.1 |
Coordinates | 395931..396239 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | - |
Locus tag | PSC79_RS02015 | Protein ID | WP_034439854.1 |
Coordinates | 395687..395929 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSC79_RS02005 (394500) | 394500..395354 | + | 855 | WP_002364921.1 | ParA family protein | - |
PSC79_RS02010 (395425) | 395425..395640 | + | 216 | WP_002355411.1 | peptide-binding protein | - |
PSC79_RS02015 (395687) | 395687..395929 | + | 243 | WP_034439854.1 | antitoxin | Antitoxin |
PSC79_RS02020 (395931) | 395931..396239 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
PSC79_RS02025 (396319) | 396319..396741 | - | 423 | WP_229236149.1 | tyrosine-type recombinase/integrase | - |
PSC79_RS02030 (396792) | 396792..397292 | - | 501 | WP_002355415.1 | HAD family hydrolase | - |
PSC79_RS02035 (397297) | 397297..398064 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
PSC79_RS02040 (398544) | 398544..398969 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
PSC79_RS02045 (398986) | 398986..399501 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
PSC79_RS02050 (399512) | 399512..400444 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 379806..397292 | 17486 | |
- | inside | Prophage | - | - | 379806..396239 | 16433 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T271288 WP_002355414.1 NZ_CP117511:395931-396239 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|