Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 16030..16601 Replicon plasmid pJXZ077-cfr-22K
Accession NZ_CP117510
Organism Enterococcus faecalis strain CQJXZ21-077

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag PSC78_RS14480 Protein ID WP_002362432.1
Coordinates 16030..16371 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PSC78_RS14485 Protein ID WP_002362431.1
Coordinates 16371..16601 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PSC78_RS14460 (11429) 11429..12712 - 1284 WP_002362438.1 hypothetical protein -
PSC78_RS14470 (14113) 14113..14715 - 603 WP_002362434.1 Fic family protein -
PSC78_RS14475 (14980) 14980..15918 - 939 WP_002362433.1 hypothetical protein -
PSC78_RS14480 (16030) 16030..16371 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PSC78_RS14485 (16371) 16371..16601 - 231 WP_002362431.1 hypothetical protein Antitoxin
PSC78_RS14490 (16805) 16805..17425 + 621 WP_013438829.1 recombinase family protein -
PSC78_RS14495 (17442) 17442..17726 + 285 WP_002394798.1 hypothetical protein -
PSC78_RS14500 (17728) 17728..17961 + 234 WP_002394799.1 hypothetical protein -
PSC78_RS14505 (18121) 18121..18375 - 255 WP_002394800.1 hypothetical protein -
PSC78_RS14510 (18492) 18492..19160 - 669 WP_002403283.1 CPBP family intramembrane metalloprotease -
PSC78_RS14515 (19196) 19196..19513 - 318 WP_002394802.1 heavy metal-binding domain-containing protein -
PSC78_RS14520 (20029) 20029..20118 + 90 WP_153829630.1 type I toxin-antitoxin system Fst family toxin -
- (20158) 20158..20222 - 65 NuclAT_0 - -
- (20158) 20158..20249 - 92 NuclAT_0 - -
- (20158) 20158..20249 - 92 NuclAT_0 - -
- (20158) 20158..20249 - 92 NuclAT_0 - -
- (20158) 20158..20249 - 92 NuclAT_0 - -
PSC78_RS14525 (20358) 20358..20654 + 297 WP_002403282.1 hypothetical protein -
PSC78_RS14530 (20813) 20813..21154 - 342 WP_002382053.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid ant(6)-Ia - 1..22455 22455


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T271287 WP_002362432.1 NZ_CP117510:c16371-16030 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT271287 WP_002362431.1 NZ_CP117510:c16601-16371 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References