Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 3613..4721 | Replicon | plasmid pJXZ077-cfr-22K |
| Accession | NZ_CP117510 | ||
| Organism | Enterococcus faecalis strain CQJXZ21-077 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | R3JIN1 |
| Locus tag | PSC78_RS14430 | Protein ID | WP_000233000.1 |
| Coordinates | 3852..4721 (+) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | PSC78_RS14425 | Protein ID | WP_000205227.1 |
| Coordinates | 3613..3837 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSC78_RS14410 (1) | 1..1008 | + | 1008 | WP_002382056.1 | replication initiator protein A | - |
| PSC78_RS14415 (1161) | 1161..1841 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| PSC78_RS14420 (1926) | 1926..3470 | + | 1545 | WP_002390960.1 | recombinase family protein | - |
| PSC78_RS14425 (3613) | 3613..3837 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PSC78_RS14430 (3852) | 3852..4721 | + | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
| PSC78_RS14435 (4702) | 4702..5436 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| PSC78_RS14440 (5469) | 5469..6377 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| PSC78_RS14445 (6374) | 6374..6574 | + | 201 | Protein_7 | hypothetical protein | - |
| PSC78_RS14450 (6654) | 6654..7816 | + | 1163 | WP_104833013.1 | IS3-like element ISSag12 family transposase | - |
| PSC78_RS14455 (7946) | 7946..8680 | + | 735 | Protein_9 | Tn3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | ant(6)-Ia | - | 1..22455 | 22455 | |
| - | inside | IScluster/Tn | ant(6)-Ia | - | 1161..7816 | 6655 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T271286 WP_000233000.1 NZ_CP117510:3852-4721 [Enterococcus faecalis]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|