Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 19452..20589 | Replicon | plasmid pJXZ077-29K |
Accession | NZ_CP117509 | ||
Organism | Enterococcus faecalis strain CQJXZ21-077 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | PSC78_RS14370 | Protein ID | WP_024417198.1 |
Coordinates | 19726..20589 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | PSC78_RS14365 | Protein ID | WP_000301765.1 |
Coordinates | 19452..19724 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSC78_RS14340 (PSC78_14340) | 15177..15347 | + | 171 | WP_000713595.1 | hypothetical protein | - |
PSC78_RS14345 (PSC78_14345) | 15361..15978 | + | 618 | WP_159162395.1 | recombinase family protein | - |
PSC78_RS14350 (PSC78_14350) | 15978..18122 | + | 2145 | WP_273961519.1 | type IA DNA topoisomerase | - |
PSC78_RS14355 (PSC78_14355) | 18225..19121 | + | 897 | WP_002387620.1 | ParA family protein | - |
PSC78_RS14360 (PSC78_14360) | 19220..19435 | + | 216 | WP_273961499.1 | peptide-binding protein | - |
PSC78_RS14365 (PSC78_14365) | 19452..19724 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
PSC78_RS14370 (PSC78_14370) | 19726..20589 | + | 864 | WP_024417198.1 | zeta toxin family protein | Toxin |
PSC78_RS14375 (PSC78_14375) | 21030..21347 | + | 318 | WP_002338433.1 | hypothetical protein | - |
PSC78_RS14380 (PSC78_14380) | 21881..22378 | + | 498 | WP_010713926.1 | molecular chaperone DnaJ | - |
PSC78_RS14385 (PSC78_14385) | 22567..23739 | + | 1173 | WP_032495458.1 | IS256-like element ISEnfa4 family transposase | - |
PSC78_RS14390 (PSC78_14390) | 24172..25221 | - | 1050 | WP_273961520.1 | 23S rRNA (adenine(2503)-C(8))-methyltransferase Cfr | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | cfr / aac(6')-aph(2'') | - | 1..29927 | 29927 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32404.02 Da Isoelectric Point: 6.9964
>T271285 WP_024417198.1 NZ_CP117509:19726-20589 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|