Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 431265..432402 | Replicon | chromosome |
Accession | NZ_CP117508 | ||
Organism | Enterococcus faecalis strain CQJXZ21-077 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | PSC78_RS02200 | Protein ID | WP_024417198.1 |
Coordinates | 431539..432402 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | PSC78_RS02195 | Protein ID | WP_000301765.1 |
Coordinates | 431265..431537 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSC78_RS02160 (426786) | 426786..428159 | + | 1374 | Protein_402 | DNA topoisomerase | - |
PSC78_RS02165 (428293) | 428293..428532 | + | 240 | WP_002425012.1 | peptide-binding protein | - |
PSC78_RS02170 (428596) | 428596..428664 | + | 69 | WP_011100846.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
PSC78_RS02175 (428789) | 428789..429526 | + | 738 | WP_032495453.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
PSC78_RS02180 (429696) | 429696..429956 | + | 261 | Protein_406 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
PSC78_RS02185 (430038) | 430038..430934 | + | 897 | WP_002387620.1 | ParA family protein | - |
PSC78_RS02190 (431033) | 431033..431248 | + | 216 | WP_273961499.1 | peptide-binding protein | - |
PSC78_RS02195 (431265) | 431265..431537 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
PSC78_RS02200 (431539) | 431539..432402 | + | 864 | WP_024417198.1 | zeta toxin family protein | Toxin |
PSC78_RS02205 (432843) | 432843..433160 | + | 318 | WP_002338433.1 | hypothetical protein | - |
PSC78_RS02210 (433694) | 433694..434191 | + | 498 | WP_010713926.1 | molecular chaperone DnaJ | - |
PSC78_RS02215 (434226) | 434226..434348 | + | 123 | WP_159111623.1 | DpnD/PcfM family protein | - |
PSC78_RS02220 (434402) | 434402..435082 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
PSC78_RS02225 (435133) | 435133..435576 | - | 444 | Protein_415 | MFS transporter | - |
PSC78_RS02230 (435777) | 435777..436187 | - | 411 | WP_231428140.1 | protein rep | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | erm(B) / tet(O/W/32/O) / fexB | - | 425493..443304 | 17811 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32404.02 Da Isoelectric Point: 6.9964
>T271266 WP_024417198.1 NZ_CP117508:431539-432402 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|